KEGG   Homo sapiens (human): 51466Help
Entry
51466             CDS       T01001                                 

Gene name
EVL, RNB6
Definition
(RefSeq) Enah/Vasp-like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 VASP_tetra Ran_BP1 Kelch_1
Motif
Other DBs
NCBI-GeneID: 51466
NCBI-ProteinID: NP_001317150
OMIM: 616912
HGNC: 20234
Ensembl: ENSG00000196405
Vega: OTTHUMG00000171530
Pharos: Q9UI08(Tbio)
UniProt: Q9UI08 A0A024R6K5
Position
14q32.2
AA seq 416 aa AA seqDB search
MSEQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVV
INYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNSQEGGPS
SQRQVQNGPSPDEMDIQRRQVMEQHQQQRQESLERRTSATGPILPPGHPSSAASAPVSCS
GPPPPPPPPVPPPPTGATPPPPPPLPAGGAQGSSHDESSMSGLAAAIAGAKLRRVQRPED
ASGGSSPSGTSKSDANRASSGGGGGGLMEEMNKLLAKRRKAASQSDKPAEKKEDESQMED
PSTSPSPGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAKSPEAKSPLQSQP
HSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacagagtatctgccaagcccgggcttccgtgatggtctacgatgacaccagt
aagaaatgggtaccaatcaaacctggccagcagggattcagccggatcaacatctaccac
aacactgccagcaacaccttcagagtcgttggagtcaagttgcaggatcagcaggttgtg
atcaattattcaatcgtgaaagggctgaagtacaatcaggccacgccaaccttccaccag
tggcgagatgcccgccaggtctacggcttaaactttgcaagtaaagaagaggcaaccacg
ttctccaatgcaatgctgtttgccctgaacatcatgaattcccaagaaggaggcccctcc
agccagcgtcaggtgcagaatggcccctctcctgatgagatggacatccagagaagacaa
gtgatggagcagcaccagcagcagcgtcaggaatctctagaaagaagaacctcggccaca
gggcccatcctcccaccaggacatccttcatctgcagccagcgcccccgtctcatgtagt
gggcctccaccgccccccccacccccagtcccacctccacccactggggctaccccacct
cccccacccccactgccagccggaggagcccaggggtccagccacgacgagagctccatg
tcaggactggccgctgccatagctggggccaagctgagaagagtccaacggccagaagac
gcatctggaggctccagtcccagtgggacctcaaagtccgatgccaaccgggcaagcagc
gggggtggcggaggaggcctcatggaggaaatgaacaaactgctggccaagaggagaaaa
gcagcctcccagtcagacaagccagccgagaagaaggaagatgaaagccaaatggaagat
cctagtacctccccctctccggggacccgagcagccagccagccacctaactcctcagag
gctggccggaagccctgggagcggagcaactcggtggagaagcctgtgtcctcgattctg
tccagaaccccgtctgtggcaaagagccccgaagctaagagcccccttcagtcgcagcct
cactctaggatgaagcctgctgggagcgtgaatgacatggccctggatgccttcgacttg
gaccggatgaagcaggagatcctagaggaggtggtgagagagctccacaaggtgaaggag
gagatcatcgacgccatcaggcaggagctgagtgggatcagcaccacgtaa

DBGET integrated database retrieval system