KEGG   Homo sapiens (human): 51475Help
Entry
51475             CDS       T01001                                 

Gene name
CABP2, DFNB93
Definition
(RefSeq) calcium binding protein 2
  KO
K23531  calcium-binding protein 1/2/4/5
Organism
hsa  Homo sapiens (human)
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51475 (CABP2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    51475 (CABP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 SPARC_Ca_bdg EF-hand_4 Dockerin_1 DIMCO_N
Motif
Other DBs
NCBI-GeneID: 51475
NCBI-ProteinID: NP_057450
OMIM: 607314
HGNC: 1385
Ensembl: ENSG00000167791
Vega: OTTHUMG00000168014
Pharos: Q9NPB3(Tbio)
UniProt: Q9NPB3
Position
11q13.2
AA seq 220 aa AA seqDB search
MGNCAKRPWRRGPKDPLQWLGSPPRGSCPSPSSSPKEQGDPAPGVQGYSVLNSLVGPACI
FLRPSIAATQLDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELI
EISQQISGGKVDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAA
LKALLGERLSQREVDEILQDVDLNGDGLVDFEEFVRMMSR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggggaactgtgccaagcggccctggcgccggggccctaaggaccccttgcagtggctc
ggctccccaccaaggggctcctgccccagccccagctccagccccaaggagcagggggac
cccgcgccaggcgtccagggctactcggtgctcaacagcctggtggggcctgcctgcatc
ttcctgcggcccagcattgccgccacccaactcgaccgggagctgcggcccgaggagatt
gaagagctgcaggtcgccttccaggagtttgaccgagaccgggacggctacattggctgc
cgggagctgggtgcctgcatgcggaccctgggctacatgcccaccgagatggagctcatc
gagatctcacaacaaatcagtggcggaaaggtggactttgaagacttcgtggagctgatg
ggccccaagctgctggcagagacggcagacatgatcggtgtccgggagctacgggacgcc
ttccgggagttcgacaccaatggggacggccgcatcagcgtgggcgagctccgggcggcc
ctcaaggccctgctgggggagcgcctcagccagcgggaggtggacgagatcctccaggac
gtggacctcaatggggacggtctggtcgacttcgaagagtttgtgcgaatgatgtctcgg
tga

DBGET integrated database retrieval system