KEGG   Homo sapiens (human): 5148
Entry
5148              CDS       T01001                                 

Gene name
PDE6G, PDEG, RP57
Definition
(RefSeq) phosphodiesterase 6G
  KO
K13759  retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04744  Phototransduction
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5148 (PDE6G)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    5148 (PDE6G)
SSDB
Motif
Pfam: PDE6_gamma
Other DBs
NCBI-GeneID: 5148
NCBI-ProteinID: NP_002593
OMIM: 180073
HGNC: 8789
Ensembl: ENSG00000185527
Vega: OTTHUMG00000178038
Pharos: P18545(Tclin)
UniProt: P18545
Position
17q25.3
AA seq 87 aa
MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGL
GTDITVICPWEAFNHLELHELAQYGII
NT seq 264 nt   +upstreamnt  +downstreamnt
atgaacctggaaccgcccaaggctgagttccggtcagccaccagggtggccgggggacct
gtcacccccaggaaagggccccctaaatttaagcagcgacagaccaggcagttcaagagc
aagcccccaaagaaaggcgttcaagggtttggggacgacatccctggaatggaaggcctg
ggaacagacatcacagtcatctgcccttgggaggccttcaaccacctggagctgcacgag
ctggcccaatatggcatcatctag

DBGET integrated database retrieval system