KEGG   Homo sapiens (human): 51490Help
Entry
51490             CDS       T01001                                 

Gene name
SPOUT1, C9orf114, CENP-32, CENP32, HSPC109
Definition
(RefSeq) SPOUT domain containing methyltransferase 1
  KO
K09142  uncharacterized protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    51490 (SPOUT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltrn_RNA_3
Motif
Other DBs
NCBI-GeneID: 51490
NCBI-ProteinID: NP_057474
OMIM: 617614
HGNC: 26933
Ensembl: ENSG00000198917
Vega: OTTHUMG00000020762
Pharos: Q5T280(Tdark)
UniProt: Q5T280
Structure
PDB: 

Position
9q34.11
AA seq 376 aa AA seqDB search
MAERGRKRPCGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEE
EAAAEKEDRGRPYTLSVALPGSILDNAQSPELRTYLAGQIARACAIFCVDEIVVFDEEGQ
DAKTVEGEFTGVGKKGQACVQLARILQYLECPQYLRKAFFPKHQDLQFAGLLNPLDSPHH
MRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCK
TYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQ
LPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYVNTCPGQGSRTIRTEEAILIS
LAALQPGLIQAGARHT
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcgcggcaggaagcggccgtgcggcccgggtgaacacggccaaaggattgag
tggcgaaaatggaagcaacagaagaaagaggagaaaaaaaaatggaaggatctcaagctg
atgaaaaaactggagcggcagcgggcacaggaggaacaggcaaagcgcctggaagaggag
gaggcagcggcagagaaggaggaccgcgggcggccctacacactgagcgtagccctgccg
ggctccatcctggacaatgctcagtcgccggagcttcgcacctacttggccggtcagatt
gccagagcctgtgccatcttctgtgtggatgagatcgtggtgtttgatgaggagggccag
gatgccaagactgtggagggggaattcacaggagttgggaagaaggggcaggcgtgcgta
cagctggcccggatcctgcagtacctggagtgtccacagtacctgaggaaggcgttcttc
cccaagcaccaggatctacagtttgcagggctcctgaaccccctggacagcccccaccac
atgcgtcaggatgaggaatccgagttccgagagggcatcgtggtggatcggcccacccgg
ccaggccacggctcctttgtcaactgtggcatgaaaaaggaggtgaagattgacaagaac
ctggagcccgggcttcgggtgactgtgcgactgaaccagcagcagcacccagactgcaag
acctaccatggcaaagtggtatcatcgcaggaccctcgcaccaaagctggtctctactgg
ggctacaccgtccgactggcttcctgcctcagtgctgtgtttgctgaggcccccttccaa
gatgggtatgacctgaccatcgggacgtcagagcgcggctcagatgtggcctctgcccag
cttcccaacttcaggcatgctcttgtggtgttcgggggcctccagggtctggaagctgga
gcggatgctgaccccaacctggaggtggctgaacccagtgtcctctttgacctgtacgtc
aatacctgtcctggccagggtagccgtaccatccgcacggaggaagccatcctcatctcc
ctggccgccctgcagcctggcctcatccaggcgggtgcccggcacacctga

DBGET integrated database retrieval system