KEGG   Homo sapiens (human): 51493
Entry
51493             CDS       T01001                                 

Gene name
RTCB, C22orf28, DJ149A16.6, FAAP, HSPC117
Definition
(RefSeq) RNA 2',3'-cyclic phosphate and 5'-OH ligase
  KO
K14415  tRNA-splicing ligase RtcB (3'-phosphate/5'-hydroxy nucleic acid ligase) [EC:6.5.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    51493 (RTCB)
Enzymes [BR:hsa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.8  3'-phosphate/5'-hydroxy nucleic acid ligase
     51493 (RTCB)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA spricing factors
   tRNA splicing ligases
    51493 (RTCB)
 Prokaryotic type
    51493 (RTCB)
SSDB
Motif
Pfam: RtcB Cu-oxidase_4
Other DBs
NCBI-GeneID: 51493
NCBI-ProteinID: NP_055121
OMIM: 613901
HGNC: 26935
Ensembl: ENSG00000100220
Vega: OTTHUMG00000030300
Pharos: Q9Y3I0(Tbio)
UniProt: Q9Y3I0
Position
22q12.3
AA seq 505 aa
MSRSYNDELQFLEKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVG
GFLPAMKQIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDI
NCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSL
REGYAWAEDKEHCEEYGRMLQADPNKVSARAKKRGLPQLGTLGAGNHYAEIQVVDEIFNE
YAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIAS
PEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDLHVIYDVSHNIAKVEQ
HVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMT
ETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTD
VVNTCHDAGISKKAIKLRPIAVIKG
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgagtcgcagctataatgatgagctgcagttcttggagaagatcaataaaaactgctgg
aggatcaagaagggcttcgtgcccaacatgcaggttgaaggtgttttctatgtgaatgat
gctctggagaaattgatgtttgaggaattaaggaatgcctgtcgaggtggtggtgttggt
ggcttcctgccagccatgaaacagattggcaatgtggcagccctgcctggaattgttcat
cgatctattgggcttcctgatgtccattcaggatatgggtttgctattgggaacatggca
gcctttgatatgaatgaccctgaagcagtagtatccccaggtggtgtcgggtttgacatc
aactgtggtgtccgcttgctaagaaccaatttagatgaaagtgatgtccagcctgtgaag
gagcaacttgcccaagctatgtttgaccacattcctgttggggtggggtcaaaaggtgtc
atcccaatgaatgccaaagacttggaggaggccttggagatgggggtggactggtcctta
agagaagggtatgcctgggctgaagacaaggagcactgcgaggagtacggaaggatgctg
caggctgaccccaataaagtttctgcaagggcgaagaaaagaggccttcctcagttgggg
accctgggagcaggcaaccattatgcagaaatccaggttgtggatgagattttcaatgag
tatgctgctaaaaaaatgggcatcgaccataagggacaggtgtgtgtgatgatccacagt
ggaagcagaggcttgggccaccaagtagccacagatgcgctggtagctatggagaaggcc
atgaagagagacaagattatagtcaatgatcggcagttggcttgtgctcgaatcgcttcc
ccagagggtcaagactatctgaagggaatggcagctgctgggaactatgcctgggtcaac
cgctcttccatgaccttcttaacccgtcaggctttcgccaaggtcttcaacacaacccct
gatgacttggacctacatgtgatctatgatgtttctcacaacattgccaaagtggagcag
catgtggtggacggaaaggaacggacactgttagtacacaggaagggatccacccgcgct
ttccctcctcaccatcccctcattgctgttgattaccaactcactggacagccagtgctc
attggtggcaccatgggaacctgtagttatgttcttactggcactgaacagggcatgact
gagacctttggaacaacctgtcatggagcgggccgtgcattgtcccgagcaaaatctcga
cgtaatttagatttccaggatgtcttagacaaattggcagatatgggaattgcgatccgt
gttgcctcacccaaactggttatggaagaggctcctgagtcctataagaatgtgacagat
gtggtaaatacctgccatgatgctggaatcagcaagaaagccattaaactgagaccaatt
gctgtgatcaaaggatag

DBGET integrated database retrieval system