KEGG   Homo sapiens (human): 515Help
Entry
515               CDS       T01001                                 

Gene name
ATP5PB, ATP5F1, PIG47
Definition
(RefSeq) ATP synthase peripheral stalk-membrane subunit b
  KO
K02127  F-type H+-transporting ATPase subunit b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    515 (ATP5PB)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    515 (ATP5PB)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    515 (ATP5PB)
   05012 Parkinson's disease
    515 (ATP5PB)
   05016 Huntington's disease
    515 (ATP5PB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mt_ATP-synt_B DUF2105 TfuA
Motif
Other DBs
NCBI-GeneID: 515
NCBI-ProteinID: NP_001679
OMIM: 603270
HGNC: 840
Ensembl: ENSG00000116459
Vega: OTTHUMG00000011745
Pharos: P24539(Tbio)
UniProt: P24539 Q08ET0
Position
1p13.2
AA seq 256 aa AA seqDB search
MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIP
EEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFV
ADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEV
TYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCI
ADLKLLAKKAQAQPVM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgggtggtactttccgccgccgccacagcggccccctctctgaagaatgca
gccttcctaggtccaggggtattgcaggcaacaaggacctttcatacagggcagccacac
cttgtccctgtaccacctcttcctgaatacggaggaaaagttcgttatggactgatccct
gaggaattcttccagtttctttatcctaaaactggtgtaacaggaccctatgtactcgga
actgggcttatcttgtacgctttatccaaagaaatatatgtgattagcgcagagaccttc
actgccctatcagtactaggtgtaatggtctatggaattaaaaaatatggtccctttgtt
gcagactttgctgataaactcaatgagcaaaaacttgcccaactagaagaggcgaagcag
gcttccatccaacacatccagaatgcaattgatacggagaagtcacaacaggcactggtt
cagaagcgccattacctttttgatgtgcaaaggaataacattgctatggctttggaagtt
acttaccgggaacgactgtatagagtatataaggaagtaaagaatcgcctggactatcat
atatctgtgcagaacatgatgcgtcgaaaggaacaagaacacatgataaattgggtggag
aagcacgtggtgcaaagcatctccacacagcaggaaaaggagacaattgccaagtgcatt
gcggacctaaagctgctggcaaagaaggctcaagcacagccagttatgtaa

DBGET integrated database retrieval system