KEGG   Homo sapiens (human): 5150Help
Entry
5150              CDS       T01001                                 

Gene name
PDE7A, HCP1, PDE7
Definition
(RefSeq) phosphodiesterase 7A
  KO
K18436  high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429 D11630
Bemoradan: D03075
Bucladesine (DG00230): D01238 D07546
Choline theophyllinate: D02017
Diprophylline: D00691
Enprofylline: D04006
Flavoxate (DG00477): D00718 D07961
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5150 (PDE7A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5150 (PDE7A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5150 (PDE7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I
Motif
Other DBs
NCBI-GeneID: 5150
NCBI-ProteinID: NP_001229247
OMIM: 171885
HGNC: 8791
Ensembl: ENSG00000205268
Vega: OTTHUMG00000164469
Pharos: Q13946(Tclin)
UniProt: Q13946
Structure
PDB: 

Position
8q13.1
AA seq 482 aa AA seqDB search
MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTA
LYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRS
SRFFRGTAVSNSLNILDDDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSL
HGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPW
DILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFS
HLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKC
ADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYL
VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENR
LS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgtgttaccagctgccggtactgcccctggacaggccggtcccccagcacgtc
ctcagccgccgaggagccatcagcttcagctccagctccgctctcttcggctgccccaat
ccccggcagctctctcagaggcgtggagctatttcctatgacagttctgatcagactgca
ttatacattcgtatgctaggagatgtacgtgtaaggagccgagcaggatttgaatcagaa
agaagaggttctcacccatatattgattttcgtattttccactctcaatctgaaattgaa
gtgtctgtctctgcaaggaatatcagaaggctactaagtttccagcgatatcttagatct
tcacgcttttttcgtggtactgcggtttcaaattccctaaacattttagatgatgattat
aatggacaagccaagtgtatgctggaaaaagttggaaattggaattttgatatctttcta
tttgatagactaacaaatggaaatagtctagtaagcttaacctttcatttatttagtctt
catggattaattgagtacttccatttagatatgatgaaacttcgtagatttttagttatg
attcaagaagattaccacagtcaaaatccttaccataacgcagtccacgctgcggatgtt
actcaggccatgcactgttacttaaaggaacctaagcttgccaattctgtaactccttgg
gatatcttgctgagcttaattgcagctgccactcatgatctggatcatccaggtgttaat
caacctttccttattaaaactaaccattacttggcaactttatacaagaatacctcagta
ctggaaaatcaccactggagatctgcagtgggcttattgagagaatcaggcttattctca
catctgccattagaaagcaggcaacaaatggagacacagataggtgctctgatactagcc
acagacatcagtcgccagaatgagtatctgtctttgtttaggtcccatttggatagaggt
gatttatgcctagaagacaccagacacagacatttggttttacagatggctttgaaatgt
gctgatatttgtaacccatgtcggacgtgggaattaagcaagcagtggagtgaaaaagta
acggaggaattcttccatcaaggagatatagaaaaaaaatatcatttgggtgtgagtcca
ctttgcgatcgtcacactgaatctattgccaacatccagattggttttatgacttaccta
gtggagcctttatttacagaatgggccaggttttccaatacaaggctatcccagacaatg
cttggacacgtggggctgaataaagccagctggaagggactgcagagagaacagtcgagc
agtgaggacactgatgctgcatttgagttgaactcacagttattacctcaggaaaatcgg
ttatcataa

DBGET integrated database retrieval system