KEGG   Homo sapiens (human): 51529
Entry
51529             CDS       T01001                                 

Gene name
ANAPC11, APC11, Apc11p, HSPC214
Definition
(RefSeq) anaphase promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51529 (ANAPC11)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    51529 (ANAPC11)
   04114 Oocyte meiosis
    51529 (ANAPC11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51529 (ANAPC11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    51529 (ANAPC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51529 (ANAPC11)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51529 (ANAPC11)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     51529 (ANAPC11)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    51529 (ANAPC11)
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX
Other DBs
NCBI-GeneID: 51529
NCBI-ProteinID: NP_001002245
OMIM: 614534
HGNC: 14452
Ensembl: ENSG00000141552
Vega: OTTHUMG00000177982
Pharos: Q9NYG5(Tbio)
UniProt: Q9NYG5
Structure
PDB: 

Position
17q25.3
AA seq 84 aa
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLHAQQVQQHCPMCRQEWKFKE
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaaggtgaagattaagtgctggaacggcgtggccacttggctctgggtggccaacgat
gagaactgtggcatctgcaggatggcatttaacggatgctgccctgactgcaaggtgccc
ggcgacgactgcccgctggtgtggggccagtgctcccactgcttccacatgcattgcatc
ctcaagtggctgcacgcacagcaggtgcagcagcactgccccatgtgccgccaggaatgg
aagttcaaggagtga

DBGET integrated database retrieval system