KEGG   Homo sapiens (human): 51537Help
Entry
51537             CDS       T01001                                 

Gene name
MTFP1, HSPC242, MTP18
Definition
(RefSeq) mitochondrial fission process 1
  KO
K17981  mitochondrial fission process protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    51537 (MTFP1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    51537 (MTFP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTP18
Motif
Other DBs
NCBI-GeneID: 51537
NCBI-ProteinID: NP_057582
OMIM: 610235
HGNC: 26945
Ensembl: ENSG00000242114
Vega: OTTHUMG00000151057
Pharos: Q9UDX5(Tbio)
UniProt: Q9UDX5 A0A024R1E4
Position
22q12.2
AA seq 166 aa AA seqDB search
MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKG
KKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLA
VRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagccgcagccgcggggcgcagagcgcgatctctaccgggacacgtgggtgcga
tacctgggctatgccaatgaggtgggcgaggctttccgctctcttgtgccagcggcggtg
gtgtggctgagctatggcgtggccagctcctacgtgctggcggatgccattgacaaaggc
aagaaggctggagaggtgcccagccctgaagcaggccgcagcgccagggtgactgtggct
gtggtggacacctttgtatggcaggctctagcctctgtggccattccgggcttcaccatc
aaccgcgtgtgtgctgcctctctctatgtcctgggcactgccacccgctggcccctggct
gtccgcaagtggaccaccaccgcgcttgggctgttgaccatccccatcattatccacccc
attgacaggtcggtggatttcctcctggactccagcctgcgcaagctctacccaacagtg
gggaagcccagctcctcctga

DBGET integrated database retrieval system