KEGG   Homo sapiens (human): 51550
Entry
51550             CDS       T01001                                 
Symbol
CINP
Name
(RefSeq) cyclin dependent kinase 2 interacting protein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CK2S
Other DBs
NCBI-GeneID: 51550
NCBI-ProteinID: NP_116019
OMIM: 613362
HGNC: 23789
Ensembl: ENSG00000100865
Pharos: Q9BW66(Tdark)
UniProt: Q9BW66 A0A024R6M9
Position
14:complement(102348282..102362890)
AA seq 212 aa
MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLN
KDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGIC
ELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTL
SYLSMWLHQPYVESDSRLHLESMLLETGHRAL
NT seq 639 nt   +upstreamnt  +downstreamnt
atggaagcaaagactcttggaactgtaacgcccagaaaacctgtcttatctgtcagtgca
agaaaaattaaggacaatgcggctgattggcacaatttaatcctgaagtgggaaaccctc
aatgatgcaggttttaccactgcaaataatattgccaacttgaaaatcagtttattgaat
aaagacaagatagaactagacagcagcagcccagcctcgaaggaaaatgaagaaaaggtg
tgtctggaatataacgaggaactggagaagctgtgtgaggaactgcaggccaccttggat
gggttgaccaaaatacaggtgaaaatggaaaagctgtcttcaactaccaagggaatttgt
gaactagaaaactaccattatggggaggagagtaaacgaccccctctgttccacacgtgg
cctacaacccatttctatgaggtttcgcataagctcttggagatgtacaggaaggagctg
ctcctgaagcgcacggtggccaaggagcttgcccacaccggggatcccgacctcaccctg
agctacctgtccatgtggctgcaccagccctatgtggagagcgacagcaggctgcatctg
gagagcatgctgctggagacaggccaccgagctctctga

DBGET integrated database retrieval system