KEGG   Homo sapiens (human): 51559Help
Entry
51559             CDS       T01001                                 

Gene name
NT5DC3, TU12B1-TY, TU12B1TY
Definition
(RefSeq) 5'-nucleotidase domain containing 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid HAD_2
Motif
Other DBs
NCBI-GeneID: 51559
NCBI-ProteinID: NP_001026871
OMIM: 611076
HGNC: 30826
Ensembl: ENSG00000111696
Vega: OTTHUMG00000157017
Pharos: Q86UY8(Tdark)
UniProt: Q86UY8
Position
12q23.3
AA seq 548 aa AA seqDB search
MTMAAAAVVARGAGARAATAAALRGGCGTAARGRPCAGPARPLCTAPGTAPDMKRYLWER
YREAKRSTEELVPSIMSNLLNPDAIFSNNEMSLSDIEIYGFDYDYTLVFYSKHLHTLIFN
AARDLLINEHRYPAEIRKYEYDPNFAIRGLHYDVQRAVLMKIDAFHYIQLGTVYRGLSVV
PDEEVIEMYEGSHVPLEQMSDFYGKSSHGNTMKQFMDIFSLPEMTLLSCVNEYFLKNNID
YEPVHLYKDVKDSIRDVHIKGIMYRAIEADIEKYICYAEQTRAVLAKLADHGKKMFLITN
SPSSFVDKGMSYIVGKDWRDLFDVVIVQAEKPNFFNDKRRPFRKMNEKGVLLWDKIHKLQ
KGQIYKQGNLYEFLKLTGWRGSRVLYFGDHIYSDLADLTLKHGWRTGAIIPELRSELKIM
NTEQYIQTMTWLQTLTGLLEQMQVHRDAESQLVLQEWKKERKEMREMTKSFFNAQFGSLF
RTDQNPTYFLRRLSRFADIYMASLSCLLNYDVSHTFYPRRTPLQHELPAWSERPPTFGTP
LLQEAQAK
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggcagcggcggcggtggtggcacgcggggccggggcgagggcagcgacagcg
gcggctttgcggggtggctgcgggaccgcggctcgggggcggccgtgtgcgggccccgcc
cggcccttgtgcactgcacccgggaccgccccggacatgaagcgctacctgtgggagcgc
taccgggaggcgaagagaagcacagaagaattggttccttccattatgagcaacttgttg
aatccagatgccattttctcaaacaatgaaatgagcctgtcagacattgaaatctatggc
ttcgattatgattacaccttggtgttttattcaaagcacctccacacgctgatatttaat
gctgcacgggaccttctcatcaatgaacaccggtatccagcagaaatcaggaagtatgag
tatgacccaaattttgcaattcgtggacttcattatgatgtacagcgggcagtattaatg
aagatcgatgcttttcattatatccagctgggaactgtctacagaggcctcagtgttgtc
cctgatgaagaagtcattgaaatgtacgaggggtcccacgtgcccttggagcagatgagt
gacttttacggaaagagctctcatggaaacacgatgaagcagttcatggacatcttctcc
ctgcccgagatgaccctcctgtcctgcgtgaatgaatacttcctcaagaacaacatcgac
tatgagcctgtgcatctgtacaaagatgtcaaggattcaattcgagacgtccacatcaaa
ggaataatgtacagagcaattgaagcagacattgaaaagtacatctgctatgctgagcag
acccgcgcagtgttggccaaactggctgatcatggcaagaagatgtttctcatcaccaat
agccccagtagctttgtggacaaagggatgagttatatcgttgggaaagactggagggac
ctgttcgatgtggtcattgttcaggctgagaagccaaacttctttaatgataagcggagg
cctttccgaaagatgaatgagaaaggtgtcttactctgggataaaatccataagttgcag
aaaggccagatatacaagcagggtaatttatatgaatttttgaagcttactggatggaga
ggatccagagtgttgtattttggtgaccatatatacagtgacctggcggatttgacccta
aagcatggctggaggactggtgcaatcatcccagagttgagatctgagctcaaaatcatg
aacacggagcaatacattcaaaccatgacctggctgcagaccttgactggcttattggaa
cagatgcaggttcacagagatgctgagtcacagctggttttgcaggagtggaaaaaggaa
aggaaggagatgcgagaaatgaccaagagtttcttcaatgcccagtttggaagcctgttc
cgcacagaccagaacccaacctacttcctaaggcgcctgtcgcgcttcgctgacatctac
atggcgtctctgagctgcctcctgaactatgacgtcagccacactttctacccccggagg
actccactgcagcacgaactgcccgcctggtcagaaaggccccccaccttcggaacccct
ctcctgcaggaggcccaggccaagtag

DBGET integrated database retrieval system