KEGG   Homo sapiens (human): 51561Help
Entry
51561             CDS       T01001                                 

Gene name
IL23A, IL-23, IL-23A, IL23P19, P19, SGRF
Definition
(RefSeq) interleukin 23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05133  Pertussis
hsa05152  Tuberculosis
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Drug target
Apilimod mesylate: D06556
Brazikumab: D10912
Briakinumab: D09588
Guselkumab: D10438
Mirikizumab: D11123
Risankizumab: D11052
Tildrakizumab: D10400
Ustekinumab: D09214
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    51561 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    51561 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    51561 (IL23A)
   04659 Th17 cell differentiation
    51561 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    51561 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    51561 (IL23A)
   05321 Inflammatory bowel disease (IBD)
    51561 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    51561 (IL23A)
   05152 Tuberculosis
    51561 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    51561 (IL23A)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   51561 (IL23A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL23 IL6
Motif
Other DBs
NCBI-GeneID: 51561
NCBI-ProteinID: NP_057668
OMIM: 605580
HGNC: 15488
Ensembl: ENSG00000110944
Vega: OTTHUMG00000187402
Pharos: Q9NPF7(Tclin)
UniProt: Q9NPF7
Structure
PDB: 

Position
12q13.3
AA seq 189 aa AA seqDB search
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgctggggagcagagctgtaatgctgctgttgctgctgccctggacagctcagggcaga
gctgtgcctgggggcagcagccctgcctggactcagtgccagcagctttcacagaagctc
tgcacactggcctggagtgcacatccactagtgggacacatggatctaagagaagaggga
gatgaagagactacaaatgatgttccccatatccagtgtggagatggctgtgacccccaa
ggactcagggacaacagtcagttctgcttgcaaaggatccaccagggtctgattttttat
gagaagctgctaggatcggatattttcacaggggagccttctctgctccctgatagccct
gtgggccagcttcatgcctccctactgggcctcagccaactcctgcagcctgagggtcac
cactgggagactcagcagattccaagcctcagtcccagccagccatggcagcgtctcctt
ctccgcttcaaaatccttcgcagcctccaggcctttgtggctgtagccgcccgggtcttt
gcccatggagcagcaaccctgagtccctaa

DBGET integrated database retrieval system