KEGG   Homo sapiens (human): 51566Help
Entry
51566             CDS       T01001                                 

Gene name
ARMCX3, ALEX3, GASP6, dJ545K15.2
Definition
(RefSeq) armadillo repeat containing X-linked 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Arm_2 Atx10homo_assoc Arm PUL
Motif
Other DBs
NCBI-GeneID: 51566
NCBI-ProteinID: NP_057691
OMIM: 300364
HGNC: 24065
Ensembl: ENSG00000102401
Vega: OTTHUMG00000022035
Pharos: Q9UH62(Tdark)
UniProt: Q9UH62 A0A024RCF9
Position
Xq22.1
AA seq 379 aa AA seqDB search
MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDW
SDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSP
QELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVK
EKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHM
LANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE
VILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKV
KVGKFMAKLAEHMFPKSQE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgggctacgccaggaaagtaggctgggtgaccgcaggcctggtgattggggctggcgcc
tgctattgcatttatagactgactaggggaagaaaacagaacaaggaaaaaatggctgag
ggtggatctggggatgtggatgatgctggggactgttctggggccaggtataatgactgg
tctgatgatgatgatgacagcaatgagagcaagagtatagtatggtacccaccttgggct
cggattgggactgaagctggaaccagagctagggccagggcaagggccagggctacccgg
gcacgtcgggctgtccagaaacgggcttcccccaattcagatgataccgttttgtcccct
caagagctacaaaaggttctttgcttggttgagatgtctgaaaagccttatattcttgaa
gcagctttaattgctctgggtaacaatgctgcttatgcatttaacagagatattattcgt
gatctgggtggtctcccaattgtcgcaaagattctcaatactcgggatcccatagttaag
gaaaaggctttaattgtcctgaataacttgagtgtgaatgctgaaaatcagcgcaggctt
aaagtatacatgaatcaagtgtgtgatgacacaatcacttctcgcttgaactcatctgtg
cagcttgctggactgagattgcttacaaatatgactgttactaatgagtatcagcacatg
cttgctaattccatttctgacttttttcgtttattttcagcgggaaatgaagaaaccaaa
cttcaggttctgaaactccttttgaatttggctgaaaatccagccatgactagggaactg
ctcagggcccaagtaccatcttcactgggctccctctttaataagaaggagaacaaagaa
gttattcttaaacttctggtcatatttgagaacataaatgataatttcaaatgggaagaa
aatgaacctactcagaatcaattcggtgaaggttcactttttttctttttaaaagaattt
caagtgtgtgctgataaggttctgggaatagaaagtcaccatgattttttggtgaaagta
aaagttggaaaattcatggccaaacttgctgaacatatgttcccaaagagccaggaataa

DBGET integrated database retrieval system