KEGG   Homo sapiens (human): 51567
Entry
51567             CDS       T01001                                 
Symbol
TDP2, AD022, EAP2, EAPII, TTRAP, dJ30M3.3, hTDP2
Name
(RefSeq) tyrosyl-DNA phosphodiesterase 2
  KO
K19619  tyrosyl-DNA phosphodiesterase 2 [EC:3.1.4.-]
Organism
hsa  Homo sapiens (human)
Disease
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    51567 (TDP2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     51567 (TDP2)
SSDB
Motif
Pfam: Exo_endo_phos UBA_4 Exo_endo_phos2 UBA_8
Other DBs
NCBI-GeneID: 51567
NCBI-ProteinID: NP_057698
OMIM: 605764
HGNC: 17768
Ensembl: ENSG00000111802
UniProt: O95551 A0A384MDM5
Structure
Position
6:complement(24649979..24666899)
AA seq 362 aa
MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNS
YFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWN
IDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFT
AIMLKKSRVKLKSQEIIPFPSTKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQ
LKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQ
MNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSDHWGLLCNLDI
IL
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggagttggggagttgcctggagggcgggagggaggcggcggaggaagagggcgagcct
gaggtgaaaaagcggcgacttctgtgtgtggagtttgcctcggtcgcaagctgcgatgcc
gcagtggctcagtgcttcctggccgagaacgactgggagatggaaagggctctgaactcc
tacttcgagcctccggtggaggagagcgccttggaacgccgacctgaaaccatctctgag
cccaagacctatgttgacctaaccaatgaagaaacaactgattccaccacttctaaaatc
agcccatctgaagatactcagcaagaaaatggcagcatgttctctctcattacctggaat
attgatggattagatctaaacaatctgtcagagagggctcgaggggtgtgttcctactta
gctttgtacagcccagatgtgatatttctacaggaagttattcccccatattatagctac
ctaaagaagagatcaagtaattatgagattattacaggtcatgaagaaggatatttcaca
gctataatgttgaagaaatcaagagtgaaattaaaaagccaagagattattccttttcca
agtaccaaaatgatgagaaaccttttatgtgtgcatgtgaacgtgtcaggaaatgagctt
tgccttatgacatcccatttggagagcaccagagggcatgctgcggaacgaatgaatcag
ttaaaaatggttttaaagaaaatgcaagaggctccagagtcagctacagttatatttgca
ggagatacaaatctaagggatcgagaggttaccagatgtggtggtttacccaacaacatt
gtggatgtctgggagtttttgggcaaacctaaacattgccagtatacatgggatacacaa
atgaactctaatcttggaataactgctgcttgtaaacttcgttttgatcgaatatttttc
agagcagcagcagaagagggacacattattccccgaagtttggaccttcttggattagaa
aaactggactgtggtagatttcctagtgatcactggggtcttctgtgcaacttagatata
atattgtaa

DBGET integrated database retrieval system