KEGG   Homo sapiens (human): 51571
Entry
51571             CDS       T01001                                 
Symbol
CYRIB, BM-009, CYRI, CYRI-B, FAM49B, L1
Name
(RefSeq) CYFIP related Rac1 interactor B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CYRIA-B_Rac1-bd V-ATPase_H_N DAHL
Other DBs
NCBI-GeneID: 51571
NCBI-ProteinID: NP_001243692
OMIM: 617978
HGNC: 25216
Ensembl: ENSG00000153310
Pharos: Q9NUQ9(Tdark)
UniProt: Q9NUQ9 A0A024R9G4
Structure
Position
8:complement(129839593..130017129)
AA seq 324 aa
MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAG
HEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQ
HLEREQALAKQFAEILHFTLRFDELKMTNPAIQNDFSYYRRTLSRMRINNVPAEGENEVN
NELANRMSLFYAEATPMLKTLSDATTKFVSENKNLPIENTTDCLSTMASVCRVMLETPEY
RSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKIDMKGCIKVLKDQPPNSVEGLL
NALRYTTKHLNDETTSKQIKSMLQ
NT seq 975 nt   +upstreamnt  +downstreamnt
atggggaatcttcttaaagttttgacatgcacagaccttgagcaggggccaaattttttc
cttgattttgaaaatgcccagcctacagagtctgagaaggaaatttataatcaggtgaat
gtagtattaaaagatgcagaaggcatcttggaggacttgcagtcatacagaggagctggc
cacgaaatacgagaggcaatccagcatccagcagatgagaagttgcaagagaaggcatgg
ggtgcagttgttccactagtaggcaaattaaagaaattttacgaattttctcagaggtta
gaagcagcattaagaggtcttctgggagccttaacaagtaccccatattctcccacccag
catctagagcgagagcaggctcttgctaaacagtttgcagaaattcttcatttcacactc
cggtttgatgaactcaagatgacaaatcctgccatacagaatgatttcagctattataga
agaacattgagtcgtatgaggattaacaatgtaccggcagaaggagaaaatgaagtaaat
aatgaattggcaaatcgaatgtctttgttttatgctgaggcaactccaatgctgaaaacc
ttgagtgatgccacaacaaaatttgtatcagagaataaaaatttaccaatagaaaatacc
acagattgtttaagcacaatggctagtgtatgcagagtcatgctggaaacaccggaatac
agaagcagatttacaaatgaagagacagtgtcattctgcttgagggtaatggtgggtgtc
ataatactctatgaccacgtacatccagtgggagcatttgctaaaacttccaaaattgat
atgaaaggttgtatcaaagttcttaaggaccaacctcctaatagtgtggaaggtcttcta
aatgctctcaggtacacaacaaaacatttgaatgatgagactacctccaagcaaattaaa
tccatgctgcaataa

DBGET integrated database retrieval system