KEGG   Homo sapiens (human): 51573
Entry
51573             CDS       T01001                                 

Gene name
GDE1, 363E6.2, MIR16
Definition
(RefSeq) glycerophosphodiester phosphodiesterase 1
  KO
K19179  glycerophosphoinositol glycerophosphodiesterase [EC:3.1.4.44]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    51573 (GDE1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.44  glycerophosphoinositol glycerophosphodiesterase
     51573 (GDE1)
SSDB
Motif
Pfam: GDPD
Other DBs
NCBI-GeneID: 51573
NCBI-ProteinID: NP_057725
OMIM: 605943
HGNC: 29644
Ensembl: ENSG00000006007
Vega: OTTHUMG00000131454
Pharos: Q9NZC3(Tbio)
UniProt: Q9NZC3
Position
16p12.3
AA seq 331 aa
MWLWEDQGGLLGPFSFLLLVLLLVTRSPVNACLLTGSLFVLLRVFSFEPVPSCRALQVLK
PRDRISAIAHRGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGIPVLMHDNTVDRTT
DGTGRLCDLTFEQIRKLNPAANHRLRNDFPDEKIPTLREAVAECLNHNLTIFFDVKGHAH
KATEALKKMYMEFPQLYNNSVVCSFLPEVIYKMRQTDRDVITALTHRPWSLSHTGDGKPR
YDTFWKHFIFVMMDILLDWSMHNILWYLCGISAFLMQKDFVSPAYLKKWSAKGIQVVGWT
VNTFDEKSYYESHLGSSYITDSMVEDCEPHF
NT seq 996 nt   +upstreamnt  +downstreamnt
atgtggctgtgggaggaccagggcggcctcctgggccctttctccttcctgctgctagtg
ctgctgctggtgacgcggagcccggtcaatgcctgcctcctcaccggcagcctcttcgtt
ctactgcgcgtcttcagctttgagccggtgccctcttgcagggccctgcaggtgctcaag
ccccgggaccgcatttctgccatcgcccaccgtggcggcagccacgacgcgcccgagaac
acgctggcggccattcggcaggcagctaagaatggagcaacaggcgtggagttggacatt
gagtttacttctgacgggattcctgtcttaatgcacgataacacagtagataggacgact
gatgggactgggcgattgtgtgatttgacatttgaacaaattaggaagctgaatcctgca
gcaaaccacagactcaggaatgatttccctgatgaaaagatccctaccctaagggaagct
gttgcagagtgcctaaaccataacctcacaatcttctttgatgtcaaaggccatgcacac
aaggctactgaggctctaaagaaaatgtatatggaatttcctcaactgtataataatagt
gtggtctgttctttcttgccagaagttatctacaagatgagacaaacagatcgggatgta
ataacagcattaactcacagaccttggagcctaagccatacaggagatgggaaaccacgc
tatgatactttctggaaacattttatatttgttatgatggacattttgctcgattggagc
atgcataatatcttgtggtacctgtgtggaatttcagctttcctcatgcaaaaggatttt
gtatccccggcctacttgaagaagtggtcagctaaaggaatccaggttgttggttggact
gttaatacctttgatgaaaagagttactacgaatcccatcttggttccagctatatcact
gacagcatggtagaagactgcgaacctcacttctag

DBGET integrated database retrieval system