KEGG   Homo sapiens (human): 5159Help
Entry
5159              CDS       T01001                                 

Gene name
PDGFRB, CD140B, IBGC4, IMF1, JTK12, KOGS, PDGFR, PDGFR-1, PDGFR1, PENTT
Definition
(RefSeq) platelet derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04630  Jak-STAT signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05230  Central carbon metabolism in cancer
hsa05231  Choline metabolism in cancer
Network
N00015  PDGF-PDGFR-RAS-ERK signaling pathway
N00016  PDGF-overexpression to RAS-ERK signaling pathway
N00028  PDGF-PDGFR-PLCG-CAMK signaling pathway
N00039  PDGF-PDGFR-PI3K signaling pathway
N00368  HPV E5 to PDGFR-PI3K signaling pathway
N00369  HPV E5 to PDGFR-RAS-ERK signaling pathway
N00385  HCMV gB to PDGFR-PI3K signaling pathway
N00386  HCMV gB to PDGFR-RAS-ERK signaling pathway
Disease
H00042  Glioma
H01574  Familial idiopathic basal ganglia calcification
H01910  Infantile myofibromatosis
Drug target
Becaplermin: D03065
Crenolanib (DG01361): D10102 D10103
Dasatinib (DG00714): D03658 D06414
Dovitinib lactate: D08907
Ilorasertib: D10423
Linifanib: D09635
Midostaurin: D05029
Motesanib (DG01262): D06678 D08947
Nilotinib (DG00716): D06413 D08953
Nintedanib (DG01374): D10396 D10481
Pazopanib: D05380
Regorafenib (DG00720): D10137 D10138
Sitravatinib: D11140
Sorafenib (DG00713): D06272 D08524
Sunitinib (DG00712): D06402 D08552
Tandutinib: D06005
Toceranib (DG01363): D08503 D08544
Vatalanib: D06285
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5159 (PDGFRB)
   04015 Rap1 signaling pathway
    5159 (PDGFRB)
   04010 MAPK signaling pathway
    5159 (PDGFRB)
   04630 Jak-STAT signaling pathway
    5159 (PDGFRB)
   04020 Calcium signaling pathway
    5159 (PDGFRB)
   04072 Phospholipase D signaling pathway
    5159 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    5159 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5159 (PDGFRB)
   04540 Gap junction
    5159 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5159 (PDGFRB)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    5159 (PDGFRB)
   05230 Central carbon metabolism in cancer
    5159 (PDGFRB)
   05231 Choline metabolism in cancer
    5159 (PDGFRB)
   05206 MicroRNAs in cancer
    5159 (PDGFRB)
  09162 Cancers: Specific types
   05214 Glioma
    5159 (PDGFRB)
   05218 Melanoma
    5159 (PDGFRB)
   05215 Prostate cancer
    5159 (PDGFRB)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    5159 (PDGFRB)
   05165 Human papillomavirus infection
    5159 (PDGFRB)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    5159 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5159 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    5159 (PDGFRB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     5159 (PDGFRB)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   5159 (PDGFRB)
CD molecules [BR:hsa04090]
 Proteins
  5159 (PDGFRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase ig Ig_3 I-set Ig_2 V-set C1-set Ig_6 TrmE_N Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5159
NCBI-ProteinID: NP_002600
OMIM: 173410
HGNC: 8804
Ensembl: ENSG00000113721
Vega: OTTHUMG00000130053
Pharos: P09619(Tclin)
UniProt: P09619 Q59F04
Structure
PDB: 

Position
5q32
AA seq 1106 aa AA seqDB search
MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGSAPV
VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFV
PDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQV
EPEPELEQLPDSGCPAPRAEAEDSFL
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttccgggtgcgatgccagctctggccctcaaaggcgagctgctgttgctgtct
ctcctgttacttctggaaccacagatctctcagggcctggtcgtcacacccccggggcca
gagcttgtcctcaatgtctccagcaccttcgttctgacctgctcgggttcagctccggtg
gtgtgggaacggatgtcccaggagcccccacaggaaatggccaaggcccaggatggcacc
ttctccagcgtgctcacactgaccaacctcactgggctagacacgggagaatacttttgc
acccacaatgactcccgtggactggagaccgatgagcggaaacggctctacatctttgtg
ccagatcccaccgtgggcttcctccctaatgatgccgaggaactattcatctttctcacg
gaaataactgagatcaccattccatgccgagtaacagacccacagctggtggtgacactg
cacgagaagaaaggggacgttgcactgcctgtcccctatgatcaccaacgtggcttttct
ggtatctttgaggacagaagctacatctgcaaaaccaccattggggacagggaggtggat
tctgatgcctactatgtctacagactccaggtgtcatccatcaacgtctctgtgaacgca
gtgcagactgtggtccgccagggtgagaacatcaccctcatgtgcattgtgatcgggaat
gaggtggtcaacttcgagtggacatacccccgcaaagaaagtgggcggctggtggagccg
gtgactgacttcctcttggatatgccttaccacatccgctccatcctgcacatccccagt
gccgagttagaagactcggggacctacacctgcaatgtgacggagagtgtgaatgaccat
caggatgaaaaggccatcaacatcaccgtggttgagagcggctacgtgcggctcctggga
gaggtgggcacactacaatttgctgagctgcatcggagccggacactgcaggtagtgttc
gaggcctacccaccgcccactgtcctgtggttcaaagacaaccgcaccctgggcgactcc
agcgctggcgaaatcgccctgtccacgcgcaacgtgtcggagacccggtatgtgtcagag
ctgacactggttcgcgtgaaggtggcagaggctggccactacaccatgcgggccttccat
gaggatgctgaggtccagctctccttccagctacagatcaatgtccctgtccgagtgctg
gagctaagtgagagccaccctgacagtggggaacagacagtccgctgtcgtggccggggc
atgccccagccgaacatcatctggtctgcctgcagagacctcaaaaggtgtccacgtgag
ctgccgcccacgctgctggggaacagttccgaagaggagagccagctggagactaacgtg
acgtactgggaggaggagcaggagtttgaggtggtgagcacactgcgtctgcagcacgtg
gatcggccactgtcggtgcgctgcacgctgcgcaacgctgtgggccaggacacgcaggag
gtcatcgtggtgccacactccttgccctttaaggtggtggtgatctcagccatcctggcc
ctggtggtgctcaccatcatctcccttatcatcctcatcatgctttggcagaagaagcca
cgttacgagatccgatggaaggtgattgagtctgtgagctctgacggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacgtgggagctgccgcgggaccagctt
gtgctgggacgcaccctcggctctggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggccacgatgaaagtggccgtcaagatgcttaaatccacagcc
cgcagcagtgagaagcaagcccttatgtcggagctgaagatcatgagtcaccttgggccc
cacctgaacgtggtcaacctgttgggggcctgcaccaaaggaggacccatctatatcatc
actgagtactgccgctacggagacctggtggactacctgcaccgcaacaaacacaccttc
ctgcagcaccactccgacaagcgccgcccgcccagcgcggagctctacagcaatgctctg
cccgttgggctccccctgcccagccatgtgtccttgaccggggagagcgacggtggctac
atggacatgagcaaggacgagtcggtggactatgtgcccatgctggacatgaaaggagac
gtcaaatatgcagacatcgagtcctccaactacatggccccttacgataactacgttccc
tctgcccctgagaggacctgccgagcaactttgatcaacgagtctccagtgctaagctac
atggacctcgtgggcttcagctaccaggtggccaatggcatggagtttctggcctccaag
aactgcgtccacagagacctggcggctaggaacgtgctcatctgtgaaggcaagctggtc
aagatctgtgactttggcctggctcgagacatcatgcgggactcgaattacatctccaaa
ggcagcacctttttgcctttaaagtggatggctccggagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtccttcgggatcctgctctgggagatcttcaccttgggt
ggcaccccttacccagagctgcccatgaacgagcagttctacaatgccatcaaacggggt
taccgcatggcccagcctgcccatgcctccgacgagatctatgagatcatgcagaagtgc
tgggaagagaagtttgagattcggccccccttctcccagctggtgctgcttctcgagaga
ctgttgggcgaaggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagt
gaccacccagccatccttcggtcccaggcccgcttgcctgggttccatggcctccgatct
cccctggacaccagctccgtcctctatactgccgtgcagcccaatgagggtgacaacgac
tatatcatccccctgcctgaccccaaacccgaggttgctgacgagggcccactggagggt
tcccccagcctagccagctccaccctgaatgaagtcaacacctcctcaaccatctcctgt
gacagccccctggagccccaggacgaaccagagccagagccccagcttgagctccaggtg
gagccggagccagagctggaacagttgccggattcggggtgccctgcgcctcgggcggaa
gcagaggatagcttcctgtag

DBGET integrated database retrieval system