KEGG   Homo sapiens (human): 51592
Entry
51592             CDS       T01001                                 

Gene name
TRIM33, ECTO, PTC7, RFG7, TF1G, TIF1G, TIF1GAMMA, TIFGAMMA
Definition
(RefSeq) tripartite motif containing 33
  KO
K08883  tripartite motif-containing protein 33 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    51592 (TRIM33)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51592 (TRIM33)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     51592 (TRIM33)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  TIF1 family [OT]
   51592 (TRIM33)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    51592 (TRIM33)
SSDB
Motif
Pfam: Bromodomain zf-B_box PHD zf-RING_UBOX zf-RING_5 zf-RING_2 zf-C3HC4 zf-C3HC4_2 UvrA_inter
Other DBs
NCBI-GeneID: 51592
NCBI-ProteinID: NP_056990
OMIM: 605769
HGNC: 16290
Ensembl: ENSG00000197323
Vega: OTTHUMG00000011891
Pharos: Q9UPN9(Tbio)
UniProt: Q9UPN9 B3KN30
Structure
PDB: 
5MR8 3U5N 3U5O 3U5P 3U5M

Position
1p13.2
AA seq 1127 aa
MAENKGGGEAESGGGGSGSAPVTAGAAGPAAQEAEPPLTAVLVEEEEEEGGRAGAEGGAA
GPDDGGVAAASSGSAQAASSPAASVGTGVAGGAVSTPAPAPASAPAPGPSAGPPPGPPAS
LLDTCAVCQQSLQSRREAEPKLLPCLHSFCLRCLPEPERQLSVPIPGGSNGDIQQVGVIR
CPVCRQECRQIDLVDNYFVKDTSEAPSSSDEKSEQVCTSCEDNASAVGFCVECGEWLCKT
CIEAHQRVKFTKDHLIRKKEDVSESVGASGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQ
LLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQ
EIKVAIFTLINEINKKGKSLLQQLENVTKERQMKLLQQQNDITGLSRQVKHVMNFTNWAI
ASGSSTALLYSKRLITFQLRHILKARCDPVPAANGAIRFHCDPTFWAKNVVNLGNLVIES
KPAPGYTPNVVVGQVPPGTNHISKTPGQINLAQLRLQHMQQQVYAQKHQQLQQMRMQQPP
APVPTTTTTTQQHPRQAAPQMLQQQPPRLISVQTMQRGNMNCGAFQAHQMRLAQNAARIP
GIPRHSGPQYSMMQPHLQRQHSNPGHAGPFPVVSVHNTTINPTSPTTATMANANRGPTSP
SVTAIELIPSVTNPENLPSLPDIPPIQLEDAGSSSLDNLLSRYISGSHLPPQPTSTMNPS
PGPSALSPGSSGLSNSHTPVRPPSTSSTGSRGSCGSSGRTAEKTSLSFKSDQVKVKQEPG
TEDEICSFSGGVKQEKTEDGRRSACMLSSPESSLTPPLSTNLHLESELDALASLENHVKI
EPADMNESCKQSGLSSLVNGKSPIRSLMHRSARIGGDGNNKDDDPNEDWCAVCQNGGDLL
CCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSP
VDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQI
PDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEI
YSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK
NT seq 3384 nt   +upstreamnt  +downstreamnt
atggcggaaaacaaaggcggcggcgaggctgagagcggcggcgggggcagcggcagcgcg
ccggtaactgccggggccgccgggcccgccgcgcaggaggcggagccgcctctcaccgcg
gtgctggtggaggaggaggaggaggaaggcggcagggccggcgctgagggcggcgcggcc
gggcccgacgacgggggggtggccgcggcctcctcgggctcggcccaggctgcttcatct
cctgcggcctcagtgggcactggagttgccgggggcgcagtatcgacgccggctccagct
ccagcctcggctcccgctccgggtccctcggcagggccgcctcctggaccgccagcctcg
ctcctggacacctgcgccgtgtgtcagcagagcttgcagagccggcgtgaggcggagccc
aagctgctgccctgtcttcactccttctgcctgcgctgcctgcccgagccggagcgccag
ctcagcgtgcccatcccggggggcagcaacggcgacatccagcaagttggtgtaatacgg
tgcccagtatgccgccaagaatgcagacagatagaccttgtggataattattttgtgaaa
gacacatctgaagctcctagcagttctgatgaaaaatcagaacaggtatgtactagttgt
gaagacaatgcaagtgcagttggcttttgtgtagaatgtggagagtggctatgtaagaca
tgtatcgaagcacatcaaagagtaaaatttactaaagatcacttgatcaggaagaaagaa
gatgtctcagagtctgttggagcatctggtcaacgccctgttttctgccctgtacacaaa
caagaacagttgaaacttttctgtgaaacatgtgatagattgacatgtagagactgtcag
ctattggaacacaaagaacataggtatcagtttttggaagaagcttttcaaaatcagaag
ggtgcaattgagaatctactggcgaaacttcttgagaagaagaattatgttcattttgca
gctactcaggtgcagaataggataaaagaagtaaatgagactaacaaacgagtagaacag
gaaattaaagtggccattttcacccttatcaatgaaattaataagaaaggaaaatctctc
ttacaacagctagagaatgttacaaaggaaagacagatgaagttactacagcagcagaat
gacatcacaggcctttcccggcaggtgaagcatgttatgaacttcacaaattgggcaatt
gcaagtggcagcagcacagcactactatacagcaagcgactgattactttccagttgcgt
catattttgaaagcacggtgtgatcctgtccctgctgctaatggagcaatacgtttccat
tgtgatcccaccttctgggcaaagaatgtagtcaatttaggtaatctagtaatagagagt
aaaccagctcctggttatactcctaatgttgtagttgggcaagttcctccagggacaaac
cacattagtaaaacccctggacagattaacttagcacagcttcgactccagcacatgcaa
caacaagtatatgcacagaaacatcagcagttgcaacagatgaggatgcagcaaccacca
gcacctgtaccaactacaacaacaacaacacaacagcatcctagacaagcagcccctcag
atgttacaacaacagcctcctcgattgatcagtgtgcaaacaatgcaaagaggcaacatg
aactgtggagcttttcaagcccatcagatgagactggctcagaatgctgccagaatacca
gggatacccaggcacagcggccctcaatattccatgatgcagccacacctccaaagacaa
cactcaaacccagggcatgctggaccctttcccgtagtatcggtacacaacaccacaatc
aacccaacgagccctactacagcaactatggcaaatgcaaaccgaggtcccaccagccca
tctgttacagcaatagagctaatcccctcagttaccaatccagaaaaccttccatcgctg
ccagatattccacccatacagttggaagatgctggctcaagtagtttagataatctacta
agtagatacatctcaggcagtcacctacccccacagcctacaagcaccatgaatccttct
ccaggtccctctgccctttctccgggatcatcaggtttatccaattctcacacacctgtg
agacccccaagtacttctagtactggcagtcgaggcagctgtgggtcatcaggaagaact
gctgagaagacaagtcttagtttcaaatctgatcaggtgaaggtcaagcaagaacctggg
actgaagatgaaatatgtagcttttcaggaggtgtaaaacaagaaaaaacagaggatggc
aggaggagtgcttgcatgttgagcagtcctgagagtagcttgacaccacctctctcaacc
aacctgcatctagaaagtgaattggatgcattggcaagcctggaaaaccatgtgaaaatt
gaacctgcagatatgaatgaaagctgcaaacagtcagggctcagcagccttgttaatgga
aagtccccaattcgaagcctcatgcacaggtcggcaaggattggaggagatggcaacaat
aaagatgatgacccaaatgaagactggtgtgctgtctgccaaaacggaggagatctcttg
tgctgcgaaaaatgtccaaaggtctttcatctaacttgtcatgttccaacactacttagc
tttccaagtggggactggatatgcacattttgtagagatattggaaagccagaagttgaa
tatgattgtgataatttgcaacatagtaagaaggggaaaactgcgcaggggttaagcccc
gtggaccaaaggaaatgtgaacgtcttctgctttacctctattgccatgaattaagtatt
gaattccaggagcctgttcctgcttcgataccaaactactataaaattataaagaaacca
atggatttatccaccgtgaaaaagaagcttcagaaaaaacattcccaacactaccaaatc
ccggatgactttgtggccgatgtccgtttgatcttcaagaactgtgaaaggtttaatgaa
atgatgaaagttgttcaagtttatgcagacacacaagagattaatttgaaggctgattca
gaagtagctcaggcagggaaagcagttgcattgtactttgaagataaactcacagagatc
tactcagacaggaccttcgcacctttgccagagtttgagcaggaagaggatgatggtgag
gtaactgaggactctgatgaagactttatacagccccgcagaaaacgcctaaagtcagat
gagagaccagtacatataaagtaa

DBGET integrated database retrieval system