KEGG   Homo sapiens (human): 51602Help
Entry
51602             CDS       T01001                                 

Gene name
NOP58, HSPC120, NOP5, NOP5/NOP58
Definition
(RefSeq) NOP58 ribonucleoprotein
  KO
K14565  nucleolar protein 58
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    51602 (NOP58)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Sno RNPs
   Box C/D snoRNPs
    51602 (NOP58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT tRNA-synt_His
Motif
Other DBs
NCBI-GeneID: 51602
NCBI-ProteinID: NP_057018
OMIM: 616742
HGNC: 29926
Ensembl: ENSG00000055044
Vega: OTTHUMG00000132840
Pharos: Q9Y2X3(Tbio)
UniProt: Q9Y2X3
Position
2q33.1
AA seq 529 aa AA seqDB search
MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF
TALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIR
SQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYI
MRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSELLPEEVEAEVKAAAEI
SMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIA
HAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISR
MLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYE
HKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEE
ETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgctgtttgaaacgtctgtgggttacgccatctttaaggttctaaatgagaag
aaacttcaagaggttgatagtttatggaaagaatttgaaactccagagaaagcaaacaaa
atagtaaagctaaaacattttgagaaatttcaggatacagcagaagcattagcagcattc
acagctctgatggagggcaaaatcaataagcagctgaaaaaagttctgaagaaaatagta
aaagaagcccatgaaccgctggcagtagctgatgctaaactaggaggggtcataaaggaa
aagctgaatctcagttgtatccatagtcctgttgttaatgaacttatgagaggaattcgt
tcacaaatggatggattaatccctggggtagaaccacgtgaaatggcagctatgtgtctt
ggattggctcacagcctgtctcgatatagattgaagtttagcgctgataaagtagacaca
atgattgttcaggcaatttccttgttagatgacttggataaagaactaaacaactacatt
atgcgatgtagagaatggtatggctggcatttccctgaattaggaaaaattatttcagat
aatttaacatactgcaagtgtttacagaaagttggcgataggaagaactatgcctctgcc
aagctttctgagttgctgccagaagaagttgaagcagaagtgaaagcagctgcagagata
tcaatgggaacagaggtttcagaagaagatatttgcaatattctgcatctttgcacccag
gtgattgaaatctctgaatatcgaacccagctctatgaatatctacaaaatcgaatgatg
gccattgcacccaatgttacagtcatggttggggaattagttggagcacggcttattgct
catgcaggttctcttttaaatttggccaagcatgcagcttctaccgttcagattcttgga
gctgaaaaggcacttttcagagccctcaaatctagacgggatacccctaagtatggtctc
atttatcatgcttcactcgtgggccagacaagtcccaaacacaaaggaaagatttctcga
atgctggcagccaaaaccgttttggctatccgttatgatgcttttggtgaggattcaagt
tctgcaatgggagttgagaacagagccaaattagaggccaggttgagaactttggaagac
agagggataagaaaaataagtggaacaggaaaagcattagcaaaaacagaaaaatatgaa
cacaaaagtgaagtgaagacttacgatccttctggtgactccacacttccaacctgttct
aaaaaacgcaaaatagaacaggtagataaagaggatgaaattactgaaaagaaagccaaa
aaagccaagattaaagttaaagttgaagaagaggaagaagaaaaagtggcagaagaagaa
gaaacatctgtgaagaagaagaagaaaaggggtaaaaagaaacacattaaggaagaacca
ctttctgaggaagaaccatgtaccagcacagcaattgctagtccagagaaaaagaagaaa
aagaaaaaaaagagagagaacgaggattaa

DBGET integrated database retrieval system