KEGG   Homo sapiens (human): 51605Help
Entry
51605             CDS       T01001                                 

Gene name
TRMT6, CGI-09, GCD10, Gcd10p
Definition
(RefSeq) tRNA methyltransferase 6
  KO
K03256  tRNA (adenine58-N1)-methyltransferase non-catalytic subunit
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    51605 (TRMT6)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    51605 (TRMT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gcd10p INTS5_C
Motif
Other DBs
NCBI-GeneID: 51605
NCBI-ProteinID: NP_057023
HGNC: 20900
Ensembl: ENSG00000089195
Vega: OTTHUMG00000031816
Pharos: Q9UJA5(Tdark)
UniProt: Q9UJA5
Structure
PDB: 

Position
20p12.3
AA seq 497 aa AA seqDB search
MEGSGEQPGPQPQHPGDHRIRDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNVIGH
SYGTAFEVTSGGSLQPKKKREEPTAETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIK
GEEIVQQLIENSTTFRDKTEFAQDKYIKKKKKKYEAIITVVKPSTRILSIMYYAREPGKI
NHMRYDTLAQMLTLGNIRAGNKMIVMETCAGLVLGAMMERMGGFGSIIQLYPGGGPVRAA
TACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPKDSALVEESNGTLEEKQASEQ
ENEDSMAEAPESNHPEDQETMETISQDPEHKGPKERGSKKDYIQEKQRRQEEQRKRHLEA
AALLSERNADGLIVASRFHPTPLLLSLLDFVAPSRPFVVYCQYKEPLLECYTKLRERGGV
INLRLSETWLRNYQVLPDRSHPKLLMSGGGGYLLSGFTVAMDNLKADTSLKSNASTLESH
ETEEPAAKKRKCPESDS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggagggctcaggggagcagccgggcccacaaccacagcatcccggagaccaccgcatc
cgcgacggcgacttcgtggtgctgaaacgtgaagatgtgtttaaagcagtacaagtccag
cggagaaaaaaagtaactttcgaaaaacagtggttctacctggataacgtcattggccat
agttatggaactgcatttgaagtgaccagtggaggaagtctacagcccaagaagaagagg
gaagagcctactgcagagactaaagaagcgggcactgataatcgaaatatagttgatgat
gggaaatctcagaaacttactcaagatgacataaaagctttgaaggacaagggcattaaa
ggagaggaaatagttcagcagttaattgaaaatagtacaacattccgagacaagacagaa
tttgcccaagataaatatattaaaaagaagaaaaaaaaatatgaagccatcattactgtt
gtgaagccatccacccgtattctttcaattatgtattatgcaagagaacctggaaaaatt
aaccacatgagatacgatacactagcccagatgttgacgttgggaaatatccgtgctggc
aacaaaatgattgtgatggaaacgtgtgcaggcttggtgctgggtgcaatgatggaacga
atgggaggttttggctccattattcagctataccctggaggaggacctgttcgggcagca
acagcatgttttggatttcccaaatcttttctcagtggtctttatgaattccctctcaac
aaagtggacagtcttctacatggaacattttctgccaagatgttatcttcagagccaaaa
gacagtgctttggttgaagaaagtaatggcacactggaggaaaaacaggcttctgaacaa
gagaatgaagacagcatggcagaggccccagagagcaaccacccagaagaccaggaaaca
atggaaacaatttctcaagatccagaacataaggggcctaaagagagaggaagcaaaaaa
gattatattcaggaaaaacagaggagacaagaagagcagaggaaaagacatttagaggct
gccgctctgctgagtgaaagaaacgcagatggtttaattgtagctagtcgtttccacccc
actcccctgctgctgtctttgctggactttgtggccccttcaaggccgtttgtggtctac
tgtcagtacaaagagcctctgttggaatgctacacaaaactgcgggagaggggaggggtc
atcaacctcaggctgtctgaaacctggctcagaaattatcaggttttgccagatcgaagt
catcctaaactgctgatgagtggaggtgggggttatcttctctccggcttcaccgttgcc
atggacaaccttaaagcagacaccagcctcaaatctaatgcaagcactttagaatcacac
gagactgaggagcctgcagctaaaaaacgaaaatgcccagagtctgactcttaa

DBGET integrated database retrieval system