KEGG   Homo sapiens (human): 51614Help
Entry
51614             CDS       T01001                                 

Gene name
ERGIC3, C20orf47, C2orf47, CGI-54, Erv46, NY-BR-84, PRO0989, SDBCAG84, dJ477O4.2
Definition
(RefSeq) ERGIC and golgi 3
  KO
K20367  endoplasmic reticulum-Golgi intermediate compartment protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51614 (ERGIC3)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    51614 (ERGIC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COPIIcoated_ERV ERGIC_N
Motif
Other DBs
NCBI-GeneID: 51614
NCBI-ProteinID: NP_057050
OMIM: 616971
HGNC: 15927
Ensembl: ENSG00000125991
Vega: OTTHUMG00000032346
Pharos: Q9Y282(Tbio)
UniProt: Q9Y282 A2TJK5
Position
20q11.22
AA seq 383 aa AA seqDB search
MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV
DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAE
RHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIE
QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI
NMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF
SVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG
LIDSLIYHSARAIQKKIDLGKTT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctggggaagctgaagcagttcgatgcctaccccaagactttggaggacttc
cgggtcaagacctgcgggggcgccaccgtgaccattgtcagtggccttctcatgctgcta
ctgttcctgtccgagctgcagtattacctcaccacggaggtgcatcctgagctctacgtg
gacaagtcgcggggagataaactgaagatcaacatcgatgtactttttccgcacatgcct
tgtgcctatctgagtattgatgccatggatgtggccggagaacagcagctggatgtggaa
cacaacctgttcaagcaacgactagataaagatggcatccccgtgagctcagaggctgag
cggcatgagcttgggaaagtcgaggtgacggtgtttgaccctgactccctggaccctgat
cgctgtgagagctgctatggtgctgaggcagaagatatcaagtgctgtaacacctgtgaa
gatgtgcgggaggcatatcgccgtagaggctgggccttcaagaacccagatactattgag
cagtgccggcgagagggcttcagccagaagatgcaggagcagaagaatgaaggctgccag
gtgtatggcttcttggaagtcaataaggtggccggaaacttccactttgcccctgggaag
agcttccagcagtcccatgtgcacgtccatgacttgcagagctttggccttgacaacatc
aacatgacccactacatccagcacctgtcatttggggaggactatccaggcattgtgaac
cccctggaccacaccaatgtcactgcgccccaagcctccatgatgttccagtactttgtg
aaggtggtgcccactgtgtacatgaaggtggacggagaggtactgaggacaaatcagttc
tctgtgaccagacatgagaaggttgccaatgggctgttgggcgaccaaggccttcccgga
gtcttcgtcctctatgagctctcgcccatgatggtgaagctgacggagaagcacaggtcc
ttcacccacttcctgacaggtgtgtgcgccatcattgggggcatgttcacagtggctgga
ctcatcgattcgctcatctaccactcagcacgagccatccagaagaaaattgatctaggg
aagacaacgtag

DBGET integrated database retrieval system