KEGG   Homo sapiens (human): 51619
Entry
51619             CDS       T01001                                 

Symbol
UBE2D4, HBUCE1
Name
(RefSeq) ubiquitin conjugating enzyme E2 D4 (putative)
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    51619 (UBE2D4)
   04120 Ubiquitin mediated proteolysis
    51619 (UBE2D4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    51619 (UBE2D4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51619 (UBE2D4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     51619 (UBE2D4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   51619 (UBE2D4)
SSDB
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Other DBs
NCBI-GeneID: 51619
NCBI-ProteinID: NP_057067
HGNC: 21647
Ensembl: ENSG00000078967
Vega: OTTHUMG00000128971
Pharos: Q9Y2X8(Tbio)
UniProt: Q9Y2X8 A0A024RA90
Position
7p13
AA seq 147 aa
MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV
PEIAHTYKADREKYNRLAREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgctaaagcggatccagaaggaattaaccgacttgcagagggatcctcctgcccag
tgttctgcaggacctgtcggtgatgacttgttccactggcaggccaccatcatgggcccg
aatgacagtccttaccaaggaggtgttttcttcctgaccatccactttcctacagattac
ccgttcaagcccccaaaggttgctttcacaaccaaaatttatcaccctaatatcaacagc
aatggcagcatctgccttgatatcctgcggtctcagtggtctccagcgttgactgtgtca
aaagttctcttgtccatctgctcgctgctctgcgaccccaaccccgatgaccccctggtg
ccagagatagcacacacctacaaggccgacagagagaagtacaacagactagcaagagag
tggacacaaaaatatgctatgtaa

KEGG   Homo sapiens (human): 7321
Entry
7321              CDS       T01001                                 

Symbol
UBE2D1, E2(17)KB1, SFT, UBC4/5, UBCH5, UBCH5A
Name
(RefSeq) ubiquitin conjugating enzyme E2 D1
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7321 (UBE2D1)
   04120 Ubiquitin mediated proteolysis
    7321 (UBE2D1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7321 (UBE2D1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7321 (UBE2D1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7321 (UBE2D1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7321 (UBE2D1)
SSDB
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Other DBs
NCBI-GeneID: 7321
NCBI-ProteinID: NP_003329
OMIM: 602961
HGNC: 12474
Ensembl: ENSG00000072401
Vega: OTTHUMG00000018269
Pharos: P51668(Tbio)
UniProt: P51668 A0A024QZJ2
Structure
PDB: 

Position
10q21.1
AA seq 147 aa
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDY
PFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV
PDIAQIYKSDKEKYNRHAREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgctgaagaggattcagaaagaattgagtgatctacagcgcgatccacctgctcac
tgttcagctggacctgtgggagatgacttgttccactggcaagccactattatggggcct
cctgatagcgcatatcaaggtggagtcttctttctcactgtacattttccgacagattat
ccttttaaaccaccaaagattgctttcacaacaaaaatttaccatccaaacataaacagt
aatggaagtatttgtctcgatattctgaggtcacaatggtcaccagctctgactgtatca
aaagttttattgtccatatgttctctactttgtgatcctaatccagatgaccccttagta
ccagatattgcacaaatctataaatcagacaaagaaaaatacaacagacatgcaagagaa
tggactcagaaatatgcaatgtaa

KEGG   Homo sapiens (human): 7322
Entry
7322              CDS       T01001                                 

Symbol
UBE2D2, E2(17)KB2, PUBC1, UBC4, UBC4/5, UBCH4, UBCH5B
Name
(RefSeq) ubiquitin conjugating enzyme E2 D2
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05131  Shigellosis
Network
nt06123  TNF signaling (viruses and bacteria)
  Element
N00942  Shigella OspG to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7322 (UBE2D2)
   04120 Ubiquitin mediated proteolysis
    7322 (UBE2D2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7322 (UBE2D2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7322 (UBE2D2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7322 (UBE2D2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7322 (UBE2D2)
SSDB
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Other DBs
NCBI-GeneID: 7322
NCBI-ProteinID: NP_003330
OMIM: 602962
HGNC: 12475
Ensembl: ENSG00000131508
Vega: OTTHUMG00000163282
Pharos: P62837(Tbio)
UniProt: P62837
Structure
PDB: 

Position
5q31.2
AA seq 147 aa
MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDREKYNRIAREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggctctgaagagaatccacaaggaattgaatgatctggcacgggaccctccagcacag
tgttcagcaggtcctgttggagatgatatgttccattggcaagctacaataatggggcca
aatgacagtccctatcagggtggagtatttttcttgacaattcatttcccaacagattac
cccttcaaaccacctaaggttgcatttacaacaagaatttatcatccaaatattaacagt
aatggcagcatttgtcttgatattctacgatcacagtggtctccagcactaactatttca
aaagtactcttgtccatctgttctctgttgtgtgatcccaatccagatgatcctttagtg
cctgagattgctcggatctacaaaacagatagagaaaagtacaacagaatagctcgggaa
tggactcagaagtatgcgatgtaa

KEGG   Homo sapiens (human): 7323
Entry
7323              CDS       T01001                                 

Symbol
UBE2D3, E2(17)KB3, UBC4/5, UBCH5C
Name
(RefSeq) ubiquitin conjugating enzyme E2 D3
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7323 (UBE2D3)
   04120 Ubiquitin mediated proteolysis
    7323 (UBE2D3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7323 (UBE2D3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7323 (UBE2D3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7323 (UBE2D3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7323 (UBE2D3)
SSDB
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Other DBs
NCBI-GeneID: 7323
NCBI-ProteinID: NP_003331
OMIM: 602963
HGNC: 12476
Ensembl: ENSG00000109332
Vega: OTTHUMG00000131119
Pharos: P61077(Tbio)
UniProt: P61077 A0A024RDH2
Structure
PDB: 

Position
4q24
AA seq 147 aa
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDRDKYNRISREWTQKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgctgaaacggattaataaggaacttagtgatttggcccgtgaccctccagcacaa
tgttctgcaggtccagttggggatgatatgtttcattggcaagccacaattatgggacct
aatgacagcccatatcaaggcggtgtattctttttgacaattcattttcctacagactac
cccttcaaaccacctaaggttgcatttacaacaagaatttatcatccaaatattaacagt
aatggcagcatttgtctcgatattctaagatcacagtggtcgcctgctttaacaatttct
aaagttcttttatccatttgttcactgctatgtgatccaaacccagatgaccccctagtg
ccagagattgcacggatctataaaacagacagagataagtacaacagaatatctcgggaa
tggactcagaagtatgccatgtga

DBGET integrated database retrieval system