KEGG   Homo sapiens (human): 51629
Entry
51629             CDS       T01001                                 

Gene name
SLC25A39, CGI-69, CGI69
Definition
(RefSeq) solute carrier family 25 member 39
  KO
K15119  solute carrier family 25, member 39/40
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    51629 (SLC25A39)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   51629 (SLC25A39)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 51629
NCBI-ProteinID: NP_001137252
OMIM: 610820
HGNC: 24279
Ensembl: ENSG00000013306
Vega: OTTHUMG00000132628
Pharos: Q9BZJ4(Tbio)
UniProt: Q9BZJ4
Position
17q21.31
AA seq 359 aa
MADQDPAGISPLQQMVASGTGAVVTSLFMTPLDVVKVRLQSQRPSMASELMPSSRLWSLS
YTKLPSSLQSTGKCLLYCNGVLEPLYLCPNGARCATWFQDPTRFTGTMDAFVKIVRHEGT
RTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGRALTSDLYAPMVAGALARLGTVTVIS
PLELMRTKLQAQHVSYRELGACVRTAVAQGGWRSLWLGWGPTALRDVPFSALYWFNYELV
KSWLNGFRPKDQTSVGMSFVAGGISGTVAAVLTLPFDVVKTQRQVALGAMEAVRVNPLHV
DSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEFGKSFFQRLNQDRLLGG
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggctgaccaggaccctgcgggcatcagccccctccagcaaatggtggcctcaggcacc
ggggctgtggttacctctctcttcatgacacccctggacgtggtgaaggttcgcctgcag
tctcagcggccctccatggccagcgagctgatgccttcctccagactgtggagcctctcc
tataccaaattgccctcctctctccaatccacagggaagtgcctcctgtattgcaatggt
gtcctggagcctctgtacctgtgcccaaatggtgcccgctgtgccacctggtttcaagac
cctacccgcttcactggcaccatggatgccttcgtgaagatcgtgaggcacgagggcacc
aggaccctctggagcggcctccccgccaccctggtgatgactgtgccagctaccgccatc
tacttcactgcctatgaccaactgaaggccttcctgtgtggtcgagccctgacctctgac
ctctacgcacccatggtggctggcgcgctggcccgcctgggcaccgtgactgtgatcagc
cccctggagcttatgcggacaaagctgcaggctcagcatgtgtcgtaccgggagctgggt
gcctgtgttcgaactgcagtggctcagggtggctggcgctcactgtggctgggctggggc
cccactgcccttcgagatgtgcccttctcagccctgtactggttcaactatgagctggtg
aagagctggctcaatgggttcaggccgaaggaccagacttctgtgggcatgagctttgtg
gctggtggcatctcagggacggtggctgcagtgctgactctaccctttgacgtggtaaag
acccaacgccaggtcgctctgggagcgatggaggctgtgagagtgaaccccctgcatgtg
gactccacctggctgctgctgcggaggatccgggccgagtcgggcaccaagggactcttt
gcaggcttccttcctcggatcatcaaggctgccccctcctgtgccatcatgatcagcacc
tatgagttcggcaaaagcttcttccagaggctgaaccaggaccggcttctgggcggctga

DBGET integrated database retrieval system