KEGG   Homo sapiens (human): 5164
Entry
5164              CDS       T01001                                 
Symbol
PDK2, PDHK2, PDKII
Name
(RefSeq) pyruvate dehydrogenase kinase 2
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05415  Diabetic cardiomyopathy
Drug target
Sodium dichloroacetate: D05857
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    5164 (PDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5164 (PDK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     5164 (PDK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   5164 (PDK2)
SSDB
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 5164
NCBI-ProteinID: NP_002602
OMIM: 602525
HGNC: 8810
Ensembl: ENSG00000005882
Pharos: Q15119(Tbio)
UniProt: Q15119
Structure
Position
17:50094737..50112152
AA seq 407 aa
MRWVWALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVR
LANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIR
NRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGST
NPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVY
VPSHLYHMLFELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI
ERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYL
KALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgcgctgggtgtgggcgctgctgaagaatgcgtccctggcaggggcgcccaagtacata
gagcacttcagcaagttctccccgtccccgctgtccatgaagcagtttctggacttcgga
tccagcaatgcctgtgagaaaacctccttcaccttcctcaggcaggagctgcctgtgcgc
ctggccaacatcatgaaagagatcaacctgcttcccgaccgagtgctgagcacaccctcc
gtgcagctggtgcagagctggtatgtccagagcctcctggacatcatggagttcctggac
aaggatcccgaggaccatcgcaccctgagccagttcactgacgccctggtcaccatccgg
aaccggcacaacgacgtggtgcccaccatggcacaaggcgtgcttgagtacaaggacacc
tacggcgatgaccccgtctccaaccagaacatccagtacttcctggaccgcttctacctc
agccgcatctccatccgcatgctcatcaaccagcacaccctcatctttgatggcagcacc
aacccagcccatcccaaacacatcggcagcatcgaccccaactgcaacgtctctgaggtg
gtcaaagatgcctacgacatggctaagctcctgtgtgacaagtattacatggcctcacct
gacctggagatccaggagatcaatgcagccaactccaaacagccgattcacatggtctac
gtcccctcccacctctaccacatgctctttgagctcttcaagaatgccatgagggcgact
gtggaaagccatgagtccagcctcattctcccacccatcaaggtcatggtggccttgggt
gaggaagatctgtccatcaagatgagtgaccgaggtgggggtgttcccttgaggaagatt
gagcgactcttcagctacatgtactccacagcacccaccccccagcctggcaccggggga
acgccgctggctggctttggttatgggctccccatttcccgcctctacgccaagtacttc
cagggagacctgcagctcttctccatggaaggctttgggaccgatgctgtcatctatctc
aaggccctgtccacggactcggtggagcgcctgcctgtctacaacaagtcagcctggcgc
cactaccagaccatccaggaggccggcgactggtgtgtgcccagcacggagcccaagaac
acgtccacgtaccgcgtcagctaa

DBGET integrated database retrieval system