KEGG   Homo sapiens (human): 51643
Entry
51643             CDS       T01001                                 

Symbol
TMBIM4, CGI-119, GAAP, LFG4, S1R, ZPRO
Name
(RefSeq) transmembrane BAX inhibitor motif containing 4
  KO
K24205  protein lifeguard
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    51643 (TMBIM4)
SSDB
Motif
Pfam: Bax1-I 7TMR-DISM_7TM
Other DBs
NCBI-GeneID: 51643
NCBI-ProteinID: NP_057140
OMIM: 616874
HGNC: 24257
Ensembl: ENSG00000155957
Vega: OTTHUMG00000168973
Pharos: Q9HC24(Tbio)
UniProt: Q9HC24
Position
12q14.3
AA seq 238 aa
MADPDPRYPRSSIEDDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYFE
SVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYD
VYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMEL
VLAAAGALLFCGFIIYDTHSLMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEAVNKK
NT seq 717 nt   +upstreamnt  +downstreamnt
atggctgaccccgacccccggtaccctcgctcctcgatcgaggacgacttcaactatggc
agcagcgtggcctccgccaccgtgcacatccgaatggcctttctgagaaaagtctacagc
attctttctctgcaggttctcttaactacagtgacttcaacagtttttttatactttgag
tctgtacggacatttgtacatgagagtcctgccttaattttgctgtttgccctcggatct
ctgggtttgatttttgcgttgattttaaacagacataagtatccccttaacctgtaccta
ctttttggatttacgctgttggaagctctgactgtggcagttgttgttactttctatgat
gtatatattattctgcaagctttcatactgactactacagtattttttggtttgactgtg
tatactctacaatctaagaaggatttcagcaaatttggagcagggctgtttgctcttttg
tggatattgtgcctgtcaggattcttgaagttttttttttatagtgagataatggagttg
gtcttagccgctgcaggagcccttcttttctgtggattcatcatctatgacacacactca
ctgatgcataaactgtcacctgaagagtacgtattagctgccatcagcctctacttggat
atcatcaatctattcctgcacctgttacggtttctggaagcagttaataaaaagtaa

DBGET integrated database retrieval system