KEGG   Homo sapiens (human): 51645Help
Entry
51645             CDS       T01001                                 

Gene name
PPIL1, CGI-124, CYPL1, PPIase, hCyPX
Definition
(RefSeq) peptidylprolyl isomerase like 1
  KO
K12733  peptidyl-prolyl cis-trans isomerase-like 1 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Module
hsa_M00355  Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    51645 (PPIL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    51645 (PPIL1)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    51645 (PPIL1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     51645 (PPIL1)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    51645 (PPIL1)
 Complex C
    51645 (PPIL1)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    51645 (PPIL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 51645
NCBI-ProteinID: NP_057143
OMIM: 601301
HGNC: 9260
Ensembl: ENSG00000137168
Vega: OTTHUMG00000014612
Pharos: Q9Y3C6(Tbio)
UniProt: Q9Y3C6 A0A024RCX8
Structure
PDB: 

Position
6p21.2
AA seq 166 aa AA seqDB search
MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDF
MIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQ
WLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaattcccccagattcctggcagccacccaacgtttacttggagaccagcatg
ggaatcattgtgctggagctgtactggaagcatgctccaaagacctgtaagaactttgct
gagttggctcgtcgaggttactacaatggcacaaaattccacagaattatcaaagacttc
atgatccaaggaggtgacccaacagggacaggtcgaggtggtgcatctatctatggcaaa
cagtttgaagatgaacttcatccagacttgaaattcacgggggctggaattctcgcaatg
gccaatgcggggccagataccaatggcagccagttctttgtgaccctcgcccccacccag
tggcttgacggcaaacacaccatttttggccgagtgtgtcagggcataggaatggtgaat
cgcgtgggaatggtagaaacaaactcccaggaccgccctgtggacgacgtgaagatcatt
aaggcatacccttctgggtag

DBGET integrated database retrieval system