KEGG   Homo sapiens (human): 51647
Entry
51647             CDS       T01001                                 
Symbol
CIAO2B, CGI-128, CIA2B, FAM96B, MIP18
Name
(RefSeq) cytosolic iron-sulfur assembly component 2B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FeS_assembly_P
Other DBs
NCBI-GeneID: 51647
NCBI-ProteinID: NP_057146
OMIM: 614778
HGNC: 24261
Ensembl: ENSG00000166595
Pharos: Q9Y3D0(Tbio)
UniProt: Q9Y3D0
Position
16:complement(66932065..66934402)
AA seq 163 aa
MVGGGGVGGGLLENANPLIYQRSGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPL
TLEELNVVEQVRVQVSDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVH
ITPGTHASEHAVNKQLADKERVAAALENTHLLEVVNQCLSARS
NT seq 492 nt   +upstreamnt  +downstreamnt
atggtaggcggcggcggggtcggcggcggcctcctggagaatgccaaccccctcatctac
cagcgctctggggagcggcctgtgacggcaggcgaggaggacgagcaggttcccgacagc
atcgacgcacgcgagatcttcgatctgattcgctccatcaatgacccggagcatccactg
acgctagaggagttgaacgtagtagagcaggtgcgggttcaggttagcgaccccgagagt
acagtggctgtggctttcacaccaaccattccgcactgcagcatggccacccttattggt
ctgtccatcaaggtcaagcttctgcgctcccttcctcagcgtttcaagatggacgtgcac
attactccggggacccatgcctcagagcatgcagtgaacaagcaacttgcagataaggag
cgggtggcagctgccctggagaacacccacctcttggaggttgtgaatcagtgcctgtca
gcccgctcctga

DBGET integrated database retrieval system