KEGG   Homo sapiens (human): 5165Help
Entry
5165              CDS       T01001                                 

Gene name
PDK3, CMTX6, GS1-358P8.4
Definition
(RefSeq) pyruvate dehydrogenase kinase 3
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
hsa  Homo sapiens (human)
Disease
H00264  Charcot-Marie-Tooth disease
Drug target
Sodium dichloroacetate: D05857
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5165 (PDK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     5165 (PDK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   5165 (PDK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 5165
NCBI-ProteinID: NP_005382
OMIM: 300906
HGNC: 8811
Ensembl: ENSG00000067992
Vega: OTTHUMG00000021269
Pharos: Q15120(Tbio)
UniProt: Q15120
Structure
PDB: 

Position
Xp22.11
AA seq 406 aa AA seqDB search
MRLFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHN
DVVPTMAQGVIEYKEKFGFDPFISTNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPVH
PKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSH
LFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRL
FNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
LSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgttccggtggctgctgaagcagccggtgcccaagcagatcgagcgctactcg
cgcttttcgccgtcgccgctctccatcaaacaattcctggacttcgggagagataatgca
tgtgagaaaacttcatatatgtttctacgaaaggaacttcctgtgcggctggctaacaca
atgagagaagttaatcttctgccggataatttacttaaccgcccttcagtgggattggtt
cagagttggtatatgcagagttttcttgaacttttagaatatgaaaataagagccctgag
gatccacaggtcttggataactttctacaagttctgattaaagtcagaaatagacacaat
gatgtggttcctacaatggcacaaggagtgattgaatacaaggagaagtttgggtttgat
cctttcattagcactaacatccaatattttctggatcggttttataccaaccgcatctct
ttccgcatgcttattaatcagcacacacttctgtttgggggtgacactaatcctgttcat
cctaaacacataggaagtatcgatcccacctgtaacgtggcggatgtggtgaaagatgca
tatgaaacagccaagatgctgtgtgaacagtattacctggtagctccagagctggaagtt
gaagaattcaatgccaaagcgccagacaaacctattcaggtggtttatgtgccctcacat
ctgtttcatatgctatttgagttgttcaagaactcaatgagagcgacagttgaactctat
gaagacagaaaagagggctaccctgctgttaaaaccctcgttactttgggtaaagaagac
ttatccattaagatcagtgacctaggtggtggtgtcccacttcgaaaaatagatcgtctt
tttaactacatgtattctactgctcctagacccagcctggagcctaccagagctgcccct
ttggctggatttggttatggtttgccaatttcccgtctgtatgctagatattttcaagga
gatctgaaactgtattccatggaaggagtgggtactgatgctgtcatttatttgaaggct
ctttcaagtgagtcatttgagagacttccagtttttaataagtccgcatggcgccattac
aagaccacgcctgaagccgatgattggagcaatcccagcagtgaacccagggatgcttca
aaatacaaagcaaaacagtaa

DBGET integrated database retrieval system