KEGG   Homo sapiens (human): 51659
Entry
51659             CDS       T01001                                 

Gene name
GINS2, HSPC037, PSF2, Pfs2
Definition
(RefSeq) GINS complex subunit 2
  KO
K10733  GINS complex subunit 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    51659 (GINS2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   GINS complex
    51659 (GINS2)
SSDB
Motif
Pfam: Sld5
Other DBs
NCBI-GeneID: 51659
NCBI-ProteinID: NP_057179
OMIM: 610609
HGNC: 24575
Ensembl: ENSG00000131153
Vega: OTTHUMG00000137646
Pharos: Q9Y248(Tbio)
UniProt: Q9Y248
Structure
PDB: 
2E9X 2Q9Q 2EHO

Position
16q24.1
AA seq 185 aa
MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRL
LPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDM
WDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLEST
QSQDF
NT seq 558 nt   +upstreamnt  +downstreamnt
atggacgctgccgaggtcgaattcctcgccgagaaggagctggttaccattatccccaac
ttcagtctggacaagatctacctcatcgggggggacctggggccttttaaccctggttta
cccgtggaagtgcccctgtggctggcgattaacctgaaacaaagacagaaatgtcgcctg
ctccctccagagtggatggatgtagaaaagttggagaagatgagggatcatgaacgaaag
gaagaaacttttaccccaatgcccagcccttactacatggaacttacgaagctcctgtta
aatcatgcttcagacaacatcccgaaggcagacgaaatccggaccctggtcaaggatatg
tgggacactcgtatagccaaactccgagtgtctgctgacagctttgtgagacagcaggag
gcacatgccaagctggataacttgaccttgatggagatcaacaccagcgggactttcctc
acacaagcgctcaaccacatgtacaaactccgcacgaacctccagcctctggagagtact
cagtctcaggacttctag

DBGET integrated database retrieval system