KEGG   Homo sapiens (human): 5166
Entry
5166              CDS       T01001                                 

Gene name
PDK4
Definition
(RefSeq) pyruvate dehydrogenase kinase 4
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
hsa  Homo sapiens (human)
Drug target
Sodium dichloroacetate: D05857
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5166 (PDK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     5166 (PDK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   5166 (PDK4)
SSDB
Motif
Pfam: BCDHK_Adom3 HATPase_c Adaptin_N
Other DBs
NCBI-GeneID: 5166
NCBI-ProteinID: NP_002603
OMIM: 602527
HGNC: 8812
Ensembl: ENSG00000004799
Vega: OTTHUMG00000153977
Pharos: Q16654(Tbio)
UniProt: Q16654 A4D1H4
Structure
PDB: 
2E0A 2ZKJ 3D2R 2ZDY 2ZDX

Position
7q21.3
AA seq 411 aa
MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQE
LPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTL
IKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIF
SDSQTGNPSHIGSIDPNCDVVAVVQDAFECSRMLCDQYYLSSPELKLTQVNGKFPDQPIH
IVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIVVLGKEDLTIKISDRGGGVPL
RIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDA
IIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaaggcggcccgcttcgtgctgcgcagcgctggctcgctcaacggcgccggcctggtg
ccccgagaggtggagcatttctcgcgctacagcccgtccccgctgtccatgaagcagcta
ctggactttggttcagaaaatgcatgtgaaagaacttcttttgcatttttgcgacaagaa
ttgcctgtgagactcgccaacattctgaaggaaattgatatcctcccgacccaattagta
aatacctcttcagtgcaattggttaaaagctggtatatacagagcctgatggatttggtg
gaattccatgagaaaagcccagatgaccagaaagcattatcagactttgtagatacactc
atcaaagttcgaaatagacaccataatgtagtccctacaatggcacaaggaatcatagag
tataaagatgcctgtacagttgacccagtcaccaatcaaaatcttcaatatttcttggat
cgattttacatgaaccgtatttctactcggatgctgatgaaccagcacattcttatattt
agtgactcacagacaggaaacccaagccacattggaagcattgatcctaactgtgatgtg
gtagcagtggtccaagatgcctttgagtgttcaaggatgctctgtgatcagtattattta
tcatctccagaattaaagcttacacaagtgaatggaaaatttccagaccaaccaattcac
atcgtgtatgttccttctcacctccatcatatgctctttgaactatttaagaatgcaatg
cgggcaacagttgaacaccaggaaaatcagccttcccttacaccaatagaggttattgtt
gtcttgggaaaagaagaccttaccattaagatttcagacagaggaggtggtgttcccctg
agaattattgaccgcctctttagttatacatactccactgcaccaacgcctgtgatggat
aattcccggaatgctcctttggctggttttggttacggcttgccaatttctcgtctgtat
gcaaagtactttcaaggagatctgaatctctactctttatcaggatatggaacagatgct
atcatctacttaaaggctttgtcttctgagtctatagaaaaacttccagtttttaacaag
tcagccttcaaacattatcagatgagctctgaggctgatgactggtgtatcccaagcagg
gaaccaaagaacctggcaaaagaagtggccatgtga

DBGET integrated database retrieval system