KEGG   Homo sapiens (human): 51661Help
Entry
51661             CDS       T01001                                 

Gene name
FKBP7, FKBP23, PPIase
Definition
(RefSeq) FKBP prolyl isomerase 7
  KO
K09573  FK506-binding protein 7 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    51661 (FKBP7)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     51661 (FKBP7)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    51661 (FKBP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 51661
NCBI-ProteinID: NP_851939
OMIM: 607062
HGNC: 3723
Ensembl: ENSG00000079150
Vega: OTTHUMG00000132577
Pharos: Q9Y680(Tbio)
UniProt: Q9Y680
Position
2q31.2
AA seq 222 aa AA seqDB search
MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHY
DGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYG
KEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEK
DEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaaccatgcatttcttattcagattcattgttttcttttatctgtggggcctt
tttactgctcagagacaaaagaaagaggagagcaccgaagaagtgaaaatagaagttttg
catcgtccagaaaactgctctaagacaagcaagaagggagacctactaaatgcccattat
gacggctacctggctaaagacggctcgaaattctactgcagccggacacaaaatgaaggc
caccccaaatggtttgttcttggtgttgggcaagtcataaaaggcctagacattgctatg
acagatatgtgccctggagaaaagcgaaaagtagttatacccccttcatttgcatacgga
aaggaaggctatgcagaaggcaagattccaccggatgctacattgatttttgagattgaa
ctttatgctgtgaccaaaggaccacggagcattgagacatttaaacaaatagacatggac
aatgacaggcagctctctaaagccgagataaacctctacttgcaaagggaatttgaaaaa
gatgagaagccacgtgacaagtcatatcaggatgcagttttagaagatatttttaagaag
aatgaccatgatggtgatggcttcatttctcccaaggaatacaatgtataccaacacgat
gaactatag

DBGET integrated database retrieval system