KEGG   Homo sapiens (human): 51665
Entry
51665             CDS       T01001                                 
Symbol
ASB1, ASB-1
Name
(RefSeq) ankyrin repeat and SOCS box containing 1
  KO
K10323  ankyrin repeat and SOCS box protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51665 (ASB1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul5 complex
    Target recognizing subunit
     51665 (ASB1)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_4 Ank_5 SOCS_box
Other DBs
NCBI-GeneID: 51665
NCBI-ProteinID: NP_001035535
OMIM: 605758
HGNC: 16011
Ensembl: ENSG00000065802
Pharos: Q9Y576(Tdark)
UniProt: Q9Y576
Position
2:238426927..238452250
AA seq 335 aa
MAEGGSPDGRAGPGSAGRNLKEWLREQFCDHPLEHCEDTRLHDAAYVGDLQTLRSLLQEE
SYRSRINEKSVWCCGWLPCTPLRIAATAGHGSCVDFLIRKGAEVDLVDVKGQTALYVAVV
NGHLESTQILLEAGADPNGSRHHRSTPVYHASRVGRADILKALIRYGADVDVNHHLTPDV
QPRFSRRLTSLVVCPLYISAAYHNLQCFRLLLLAGANPDFNCNGPVNTQGFYRGSPGCVM
DAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRGRRKVDPEALQVFKEARSVPRTLL
CLCRVAVRRALGKHRLHLIPSLPLPDPIKKFLLHE
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcggagggcggcagcccagacgggcgggcagggccgggctccgcaggtcgtaatctg
aaggagtggctgagggagcaattttgtgatcatccgctggagcactgtgaggacacgagg
ctccatgatgcagcttacgtcggggacctccagaccctcaggagcctattgcaagaggag
agctaccggagccgcatcaacgagaagtctgtctggtgctgtggctggctcccctgcaca
ccgttgcgaatcgcggccactgcaggccatgggagctgtgtggacttcctcatccggaag
ggggccgaggtggatctggtggacgtaaaaggacagacggccctgtatgtggctgtggtg
aacgggcacctagagagtacccagatccttctcgaagctggcgcggaccccaacggaagc
cggcaccatcgcagcacccctgtctaccacgcctctcgcgtgggccgggcagacatcctg
aaggccctcatcaggtacggggctgatgttgacgtcaaccaccacctgactcctgatgtc
cagcctcgattctcccggcggctcacctccttggtggtctgccccttgtacatcagcgca
gcctaccacaacctccagtgcttccggctgctcctcctggctggcgcgaaccctgacttc
aactgcaatggtcctgtcaacacacagggattctacaggggctcccctgggtgcgtcatg
gatgctgttctgcgccacggctgtgaggcagccttcgtgagcctgctggtagaatttgga
gccaacctgaatctagtgaagtgggaatcgctgggcccagagtcgagaggaagaagaaaa
gtggaccctgaggccttgcaggtctttaaagaggccagaagtgttcccagaaccttgctg
tgtctgtgccgtgtggctgtgagaagagctcttggcaaacaccggcttcatctgattcct
tcgctgcctctgccagaccccataaagaagtttctactccatgagtag

DBGET integrated database retrieval system