KEGG   Homo sapiens (human): 51668Help
Entry
51668             CDS       T01001                                 

Gene name
HSPB11, C1orf41, HSPCO34, IFT25, PP25
Definition
(RefSeq) heat shock protein family B (small) member 11
  KO
K19369  heat shock protein beta-11
Organism
hsa  Homo sapiens (human)
Disease
H00264  Charcot-Marie-Tooth disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    51668 (HSPB11)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51668 (HSPB11)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP20
   51668 (HSPB11)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Intraflagellar transport (IFT) complex B
    51668 (HSPB11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F5_F8_type_C XRCC1_N ANAPC10
Motif
Other DBs
NCBI-GeneID: 51668
NCBI-ProteinID: NP_001303864
HGNC: 25019
Ensembl: ENSG00000081870
Vega: OTTHUMG00000008408
Pharos: Q9Y547(Tdark)
UniProt: Q9Y547
Structure
PDB: 

Position
1p32.3
AA seq 144 aa AA seqDB search
MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIE
RLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIV
SAFDHFASVHSVSAEGTVVSNLSS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgatctctgtctgagctctgaagggtccgaagtgattttagctacatca
agtgatgaaaaacacccacctgaaaatatcattgatgggaatccagaaacgttttggacc
accacaggaatgtttccccaggaattcattatttgtttccacaaacatgtaaggattgaa
aggcttgtaatccaaagttactttgtacagaccttgaagattgaaaaaagcacgtctaaa
gagccagttgattttgagcaatggattgaaaaagatttggtacacacagaggggcagctt
caaaatgaagaaattgtggcacatgatggctccgctacttacttgagattcattattgta
tcagcctttgatcattttgcatctgtgcatagcgtttctgcagaaggaacagtagtctca
aatctttcctcataa

DBGET integrated database retrieval system