KEGG   Homo sapiens (human): 51678Help
Entry
51678             CDS       T01001                                 

Gene name
MPP6, PALS2, VAM-1, VAM1, p55T
Definition
(RefSeq) membrane palmitoylated protein 6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin L27 SH3_2 PDZ SH3_1 SH3_9 PDZ_2 Tricorn_PDZ
Motif
Other DBs
NCBI-GeneID: 51678
NCBI-ProteinID: NP_001289966
OMIM: 606959
HGNC: 18167
Ensembl: ENSG00000105926
Vega: OTTHUMG00000023507
Pharos: Q9NZW5(Tbio)
UniProt: Q9NZW5 A0A024RA25
Position
7p15.3
AA seq 540 aa AA seqDB search
MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELV
NEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSSINN
QLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNG
HEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQVFVKCHFDYNPYNDNLIPCKEAG
LKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGT
ISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIV
LNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKID
SILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKL
LTDSDLKKTVDESARIQRAYNHYFDLIIINDNLDKAFEKLQTAIEKLRMEPQWVPISWVY
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagtcttggaaaaccttacggagctgccctcgtctactggagcagaagaaata
gacctaattttcctcaagggaattatggagaatcctattgtaaaatcacttgctaaggct
catgagaggctagaagattccaaactagaagctgtcagtgacaataacttggaattagtc
aatgaaattcttgaagacatcactcctctaataaatgtggatgaaaatgtggcagaattg
gttggtatactcaaagaacctcacttccagtcactgttggaggcccatgatattgtggca
tcaaagtgttatgattcacctccatcaagcccagaaatgaataattcttctatcaataat
cagttattaccagtagatgccattcgtattcttggtattcacaaaagagctggggaacca
ctgggtgtgacatttagggttgaaaataatgatctggtaattgcccgaatcctccatggg
ggaatgatagatcgacaaggtctacttcatgtgggagatataattaaagaagtcaatggc
catgaggttggaaataatccaaaggaattacaagaattactgaaaaatattagtggaagt
gtcaccctaaaaatcttaccaagttatagagataccattactcctcaacaggtatttgtg
aagtgtcattttgattataatccatacaatgacaacctaataccttgcaaagaagcagga
ttgaagttttccaaaggagagattcttcagattgtaaatagagaagatccaaattggtgg
caggctagccatgtaaaagagggaggaagcgctggtctcattccaagccagttcctggaa
gagaagagaaaggcatttgttagaagagactgggacaattcaggacctttttgtggaact
ataagtagcaaaaaaaagaaaaagatgatgtatctcacaaccagaaatgcagaatttgat
cgtcatgaaatccagatatatgaggaggtagccaaaatgcctcccttccagagaaaaaca
ttagtattgataggagctcaaggtgtaggccgaagaagcttgaaaaacaggttcatagta
ttgaatcccactagatttggaactacggtgccatttacttcacggaaaccaagggaagat
gaaaaagatggccaggcatataagtttgtgtcacgatctgagatggaagcagatattaaa
gctggaaagtatttggaacatggggaatatgaaggaaatctctatggaaccaaaattgat
tctattcttgaggttgtccaaactggacggacttgcattctggatgtcaacccacaagca
ctgaaagtattgaggacatcagagtttatgccctatgtggtatttattgcggctccggag
ctagagacgttacgtgccatgcacaaggctgtggtggatgcaggaatcactaccaagctt
ctgaccgactctgacttgaagaaaacagtggatgaaagtgcacggattcagagagcatac
aaccactattttgatttgatcatcataaatgataatctagacaaagcctttgaaaaactg
caaactgccatagagaaactgagaatggaaccacagtgggtcccaatcagctgggtttac
tga

DBGET integrated database retrieval system