KEGG   Homo sapiens (human): 5168Help
Entry
5168              CDS       T01001                                 

Gene name
ENPP2, ATX, ATX-X, AUTOTAXIN, LysoPLD, NPP2, PD-IALPHA, PDNP2
Definition
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase 2
  KO
K01122  ectonucleotide pyrophosphatase/phosphodiesterase family member 2 [EC:3.1.4.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    5168 (ENPP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.39  alkylglycerophosphoethanolamine phosphodiesterase
     5168 (ENPP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest Somatomedin_B Endonuclease_NS Sulfatase
Motif
Other DBs
NCBI-GeneID: 5168
NCBI-ProteinID: NP_001035181
OMIM: 601060
HGNC: 3357
Ensembl: ENSG00000136960
Vega: OTTHUMG00000164995
Pharos: Q13822(Tchem)
UniProt: Q13822
Structure
PDB: 

Position
8q24.12
AA seq 863 aa AA seqDB search
MARRSSFQSCQIISLFTFAVGVNICLGFTAHRIKRAEGWEEGPPTVLSDSPWTNISGSCK
GRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHC
SEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
TFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHER
PSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDH
GMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLTCKKPDQH
FKPYLKQHLPKRLHYANNRRIEDIHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNK
VNSMQTVFVGYGSTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTF
RPTMPEEVTRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYG
RPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSSVPDHLTSCVRPDVRVS
PSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVL
VKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYSIITSCLDFTQ
PADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFR
KTSRSYPEILTLKTYLHTYESEI
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaggagctcgttccagtcgtgtcagataatatccctgttcacttttgccgtt
ggagtcaatatctgcttaggattcactgcacatcgaattaagagagcagaaggatgggag
gaaggtcctcctacagtgctatcagactccccctggaccaacatctccggatcttgcaag
ggcaggtgctttgaacttcaagaggctggacctcctgattgtcgctgtgacaacttgtgt
aagagctataccagttgctgccatgactttgatgagctgtgtttgaagacagcccgtggc
tgggagtgtactaaggacagatgtggagaagtcagaaatgaagaaaatgcctgtcactgc
tcagaggactgcttggccaggggagactgctgtaccaattaccaagtggtttgcaaagga
gagtcgcattgggttgatgatgactgtgaggaaataaaggccgcagaatgccctgcaggg
tttgttcgccctccattaatcatcttctccgtggatggcttccgtgcatcatacatgaag
aaaggcagcaaagtcatgcctaatattgaaaaactaaggtcttgtggcacacactctccc
tacatgaggccggtgtacccaactaaaacctttcctaacttatacactttggccactggg
ctatatccagaatcacatggaattgttggcaattcaatgtatgatcctgtatttgatgcc
acttttcatctgcgagggcgagagaaatttaatcatagatggtggggaggtcaaccgcta
tggattacagccaccaagcaaggggtgaaagctggaacattcttttggtctgttgtcatc
cctcacgagcggagaatattaaccatattgcagtggctcaccctgccagatcatgagagg
ccttcggtctatgccttctattctgagcaacctgatttctctggacacaaatatggccct
ttcggccctgagatgacaaatcctctgagggaaatcgacaaaattgtggggcaattaatg
gatggactgaaacaactaaaactgcatcggtgtgtcaacgtcatctttgtcggagaccat
ggaatggaagatgtcacatgtgatagaactgagttcttgagtaattacctaactaatgtg
gatgatattactttagtgcctggaactctaggaagaattcgatccaaatttagcaacaat
gctaaatatgaccccaaagccattattgccaatctcacgtgtaaaaaaccagatcagcac
tttaagccttacttgaaacagcaccttcccaaacgtttgcactatgccaacaacagaaga
attgaggatatccatttattggtggaacgcagatggcatgttgcaaggaaacctttggat
gtttataagaaaccatcaggaaaatgctttttccagggagaccacggatttgataacaag
gtcaacagcatgcagactgtttttgtaggttatggctcaacatttaagtacaagactaaa
gtgcctccatttgaaaacattgaactttacaatgttatgtgtgatctcctgggattgaag
ccagctcctaataatgggacccatggaagtttgaatcatctcctgcgcactaataccttc
aggccaaccatgccagaggaagttaccagacccaattatccagggattatgtaccttcag
tctgattttgacctgggctgcacttgtgatgataaggtagagccaaagaacaagttggat
gaactcaacaaacggcttcatacaaaagggtctacagaagagagacacctcctctatggg
cgacctgcagtgctttatcggactagatatgatatcttatatcacactgactttgaaagt
ggttatagtgaaatattcctaatgccactctggacatcatatactgtttccaaacaggct
gaggtttccagcgttcctgaccatctgaccagttgcgtccggcctgatgtccgtgtttct
ccgagtttcagtcagaactgtttggcctacaaaaatgataagcagatgtcctacggattc
ctctttcctccttatctgagctcttcaccagaggctaaatatgatgcattccttgtaacc
aatatggttccaatgtatcctgctttcaaacgggtctggaattatttccaaagggtattg
gtgaagaaatatgcttcggaaagaaatggagttaacgtgataagtggaccaatcttcgac
tatgactatgatggcttacatgacacagaagacaaaataaaacagtacgtggaaggcagt
tccattcctgttccaactcactactacagcatcatcaccagctgtctggatttcactcag
cctgccgacaagtgtgacggccctctctctgtgtcctccttcatcctgcctcaccggcct
gacaacgaggagagctgcaatagctcagaggacgaatcaaaatgggtagaagaactcatg
aagatgcacacagctagggtgcgtgacattgaacatctcaccagcctggacttcttccga
aagaccagccgcagctacccagaaatcctgacactcaagacatacctgcatacatatgag
agcgagatttaa

DBGET integrated database retrieval system