KEGG   Homo sapiens (human): 51690
Entry
51690             CDS       T01001                                 

Symbol
LSM7, YNL147W
Name
(RefSeq) LSM7 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12626  U6 snRNA-associated Sm-like protein LSm7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    51690 (LSM7)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    51690 (LSM7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    51690 (LSM7)
   03041 Spliceosome [BR:hsa03041]
    51690 (LSM7)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     51690 (LSM7)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     51690 (LSM7)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    51690 (LSM7)
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 51690
NCBI-ProteinID: NP_057283
OMIM: 607287
HGNC: 20470
Ensembl: ENSG00000130332
Vega: OTTHUMG00000180441
Pharos: Q9UK45(Tdark)
UniProt: Q9UK45
Structure
PDB: 
5O9Z 6AH0 3JCR

Position
19p13.3
AA seq 103 aa
MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDD
QYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA
NT seq 312 nt   +upstreamnt  +downstreamnt
atggcggataaggagaagaagaaaaaggagagcatcttggacttgtccaagtacatcgac
aagacgatccgggtaaagttccagggaggccgcgaagccagtggaatcctgaagggcttc
gacccactcctcaaccttgtgctggacggcaccattgagtacatgcgagaccctgacgac
cagtacaagctcacggaggacacccggcagctgggcctcgtggtgtgccggggcacgtcc
gtggtgctaatctgcccgcaggacggcatggaggccatccccaaccccttcatccagcag
caggacgcctag

DBGET integrated database retrieval system