KEGG   Homo sapiens (human): 51691
Entry
51691             CDS       T01001                                 

Symbol
LSM8, NAA38
Name
(RefSeq) LSM8 homolog, U6 small nuclear RNA associated
  KO
K12627  U6 snRNA-associated Sm-like protein LSm8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    51691 (LSM8)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    51691 (LSM8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    51691 (LSM8)
   03041 Spliceosome [BR:hsa03041]
    51691 (LSM8)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     51691 (LSM8)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     51691 (LSM8)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    51691 (LSM8)
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 51691
NCBI-ProteinID: NP_057284
OMIM: 607288
HGNC: 20471
Ensembl: ENSG00000128534
Vega: OTTHUMG00000156956
Pharos: O95777(Tdark)
UniProt: O95777 A4D0W0
Structure
PDB: 
5O9Z 6AH0 3JCR

Position
7q31.31
AA seq 96 aa
MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLY
IVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH
NT seq 291 nt   +upstreamnt  +downstreamnt
atgacgtccgctttggagaactacatcaaccgaactgttgccgttattacatcagatggg
agaatgattgtgggaacactgaaaggttttgaccagaccattaatttgattttggatgaa
agccatgaacgagtattcagctcttcacagggggtagaacaagtggtactaggattatac
attgtaagaggtgacaacgttgcagtcattggagaaatcgatgaagaaacagattctgcg
cttgatttggggaatattcgagcagaacctttaaattctgtagcacactga

DBGET integrated database retrieval system