KEGG   Homo sapiens (human): 51692
Entry
51692             CDS       T01001                                 
Symbol
CPSF3, CPSF-73, CPSF73
Name
(RefSeq) cleavage and polyadenylation specific factor 3
  KO
K14403  cleavage and polyadenylation specificity factor subunit 3 [EC:3.1.27.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    51692 (CPSF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    51692 (CPSF3)
   03019 Messenger RNA biogenesis [BR:hsa03019]
    51692 (CPSF3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.-
     51692 (CPSF3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     51692 (CPSF3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     51692 (CPSF3)
    U7-dependent histone pre-mRNA processing factors
     51692 (CPSF3)
SSDB
Motif
Pfam: CPSF73-100_C Beta-Casp Lactamase_B Lactamase_B_6 RMMBL Lactamase_B_2 Lactamase_B_3 Beta_lactamase3
Other DBs
NCBI-GeneID: 51692
NCBI-ProteinID: NP_057291
OMIM: 606029
HGNC: 2326
Ensembl: ENSG00000119203
Pharos: Q9UKF6(Tbio)
UniProt: Q9UKF6
Structure
Position
2:9423654..9473101
AA seq 684 aa
MSAIPAEESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLID
PAEIDLLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADD
MLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHAGHVLGAAMFMIEIAGVKLLYTGDF
SRQEDRHLMAAEIPNIKPDILIIESTYGTHIHEKREEREARFCNTVHDIVNRGGRGLIPV
FALGRAQELLLILDEYWQNHPELHDIPIYYASSLAKKCMAVYQTYVNAMNDKIRKQININ
NPFVFKHISNLKSMDHFDDIGPSVVMASPGMMQSGLSRELFESWCTDKRNGVIIAGYCVE
GTLAKHIMSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGE
QNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNFRGEKLAKVMGFLADKKPEQGQR
VSGILVKRNFNYHILSPCDLSNYTDLAMSTVKQTQAIPYTGPFNLLCYQLQKLTGDVEEL
EIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK
VSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSE
DDESLREMVELAAQRLYEALTPVH
NT seq 2055 nt   +upstreamnt  +downstreamnt
atgtctgcgattcctgctgaggagagcgaccagctgctgatccgaccccttggagctggg
caagaagtaggaagatcatgtattattctcgagttcaaaggaagaaaaataatgctcgac
tgtgggatccaccctggcctagaaggaatggatgctcttccttatattgatttaattgac
ccagctgagattgatctcctattaattagtcatttccatttggatcactgtggagctctg
ccctggtttctacagaagacaagtttcaaaggaagaacatttatgactcatgccacaaaa
gctatttatagatggcttctttctgattatgtcaaagttagtaacatatcagcagacgac
atgctgtataccgagacagatttggaagaaagcatggacaaaattgaaactatcaacttt
catgaagttaaggaagttgcgggaatcaagttttggtgttaccatgcaggtcacgtccta
ggagccgccatgttcatgattgagatcgcaggcgtgaagcttttgtacactggtgatttc
tcaagacaagaagataggcacttaatggcagctgaaattcctaatattaagcctgatatt
cttatcattgaatctacttatgggacccatatccatgagaaacgtgaagagcgagaagca
agattctgtaacactgtccacgatattgtaaacagaggaggcaggggtctcattcctgtc
tttgctcttggaagggctcaggagctgctcttgattctagatgagtactggcagaatcac
ccagaactacatgacattccaatatactatgcatcatctttggccaagaagtgtatggca
gtgtaccagacatatgtaaatgccatgaatgacaaaatccgcaaacagatcaacatcaat
aatccctttgttttcaaacacattagtaacctcaagagcatggatcattttgatgacatt
ggtcccagtgttgtaatggcctccccaggcatgatgcaaagtggcttatccagagaatta
tttgaaagctggtgtactgataagaggaatggtgtcattatagcgggatactgtgtagaa
gggacacttgccaagcacatcatgtctgaacctgaagaaatcactactatgtctggacag
aagttaccactgaaaatgtctgttgattacatttctttctcagctcacacggattaccag
caaaccagtgaatttattcgtgctttgaaaccgcctcatgtgattttagtccatggagaa
cagaatgaaatggccagattgaaagcagcactgattcgagaatatgaagataacgatgaa
gttcacatagaggttcataatcctcggaatacagaagcagtgaccttaaacttcagagga
gaaaaactagccaaggttatgggatttttagcagacaaaaaaccagaacaaggccagcgg
gtctcaggaatacttgttaaaagaaactttaattatcacatactttctccttgcgacctg
tccaattatactgacctggccatgagcacggtgaagcagacccaagccattccatatact
ggtccctttaatttgctctgttaccagctgcagaaattgacaggtgatgtggaagaatta
gaaattcaagaaaaacctgctctgaaagtgttcaaaaatattactgtaatacaagaacca
ggcatggtggtattagaatggctggcaaacccttctaatgatatgtatgcagatacagta
acaactgtgatattggaagttcagtcaaatcccaaaataagaaaaggtgcagtacagaag
gtttctaaaaaattagaaatgcacgtttacagcaagaggttggagatcatgctccaggac
atatttggagaagactgtgtaagtgtaaaggatgactctattcttagcgtcacagtggac
gggaaaactgccaaccttaacttggagacacggactgtagaatgtgaagagggaagtgaa
gacgatgaatccctccgagaaatggtggagctggctgcacagagactgtacgaggccctg
acgccagttcactga

DBGET integrated database retrieval system