KEGG   Homo sapiens (human): 51693
Entry
51693             CDS       T01001                                 

Gene name
TRAPPC2L, HSPC176, PERRB
Definition
(RefSeq) trafficking protein particle complex 2 like
  KO
K20301  trafficking protein particle complex subunit 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51693 (TRAPPC2L)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    51693 (TRAPPC2L)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   TRAPP complex I
    51693 (TRAPPC2L)
SSDB
Motif
Pfam: Sedlin_N Sybindin
Other DBs
NCBI-GeneID: 51693
NCBI-ProteinID: NP_057293
OMIM: 610970
HGNC: 30887
Ensembl: ENSG00000167515
Vega: OTTHUMG00000137861
Pharos: Q9UL33(Tdark)
UniProt: Q9UL33
Position
16q24.3
AA seq 140 aa
MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGL
LYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGD
RIQSSRAFDNMVTSMMIQVC
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcggtgtgcatcgcggtgattgccaaggagaattaccccctctacattcgcagcacc
cctacggagaacgagctgaagttccactacatggtgcacacatctctggacgtggtggat
gagaagatctccgcaatggggaaggccctggtcgaccagagggagctgtacctgggcctg
ctctaccccacggaggactacaaggtatacggctacgtcaccaactccaaggtgaagttt
gtcatggtggtagattcctccaacacagcccttcgagacaacgaaattcgcagcatgttc
cggaagctacacaactcctacacagacgtgatgtgcaaccccttctacaacccgggggac
cgcatccagtccagcagggcctttgataacatggtgacgtcgatgatgatacaggtgtgc
tga

DBGET integrated database retrieval system