KEGG   Homo sapiens (human): 51696
Entry
51696             CDS       T01001                                 
Symbol
HECA, HDC, HDCL, HHDC, dJ225E12.1
Name
(RefSeq) hdc homolog, cell cycle regulator
  KO
K23049  headcase protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    51696 (HECA)
SSDB
Motif
Pfam: Headcase HECA Glyco_hydro_20 VATC
Other DBs
NCBI-GeneID: 51696
NCBI-ProteinID: NP_057301
OMIM: 607977
HGNC: 21041
Ensembl: ENSG00000112406
Pharos: Q9UBI9(Tbio)
UniProt: Q9UBI9
Position
6:139135080..139180802
AA seq 543 aa
MPNPKNSKGGRKNKRANSSGDEQENGAGALAAAGAAGAAAGGALAAAAGCGAAAAGAPGA
GGAAGAGGAGTGAANAAAAAGAAAAGDAKNEAPCATPLICSFGRPVDLEKDDYQKVVCNN
EHCPCSTWMHLQCFYEWESSILVQFNCIGRARSWNEKQCRQNMWTKKGYDLAFRFCSCRC
GQGHLKKDTDWYQVKRMQDEKKKKSGSEKNTGRPPGEAAEEAKKCRPPNKPQKGPSHDLP
RRHSMDRQNSQEKAVGAAAYGARSPGGSPGQSPPTGYSILSPAHFSGPRSSRYLGEFLKN
AIHLEPHKKAMAGGHVFRNAHFDYSPAGLAVHRGGHFDTPVQFLRRLDLSELLTHIPRHK
LNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVFEQFPLVDGTLFL
SPSRHDEIEYDVPCHLQGRLMHLYAVCVDCLEGVHKIICIKCKSRWDGSWHQLGTMYTYD
ILAASPCCQARLNCKHCGKPVIDVRIGMQYFSEYSNVQQCPHCGNLDYHFVKPFSSFKVL
EAY
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgcccaaccccaaaaacagcaaaggcggccgcaaaaacaagcgcgccaacagcagcggc
gacgagcaggaaaatggagccggggccctggcagcggcgggcgcggcgggagcggcggcc
gggggggccctggcggcggcggccggttgcggggcggcggcggcgggcgcgccgggcgcc
ggaggcgcggcgggcgccggaggcgcggggactggcgccgcgaacgctgcggccgccgcg
ggggctgcggccgcgggcgatgccaaaaacgaagccccatgtgccactcccctgatctgc
agcttcggtaggccggtggacctggagaaggacgactaccagaaggtggtgtgcaacaac
gagcactgcccctgcagcacctggatgcacctgcagtgcttctacgagtgggagagcagc
atcctcgtccagttcaactgcatcggccgcgcgcgcagctggaacgagaagcaatgccgc
cagaacatgtggacaaagaagggctacgacctggccttccgcttctgctcttgccgctgt
ggccagggccacttgaagaaggacacagactggtatcaggtgaagcggatgcaggacgag
aaaaagaagaagtctggctccgagaagaacacagggaggcctcctggtgaggcggcggag
gaggcaaaaaagtgcaggcccccaaataagccccagaaaggcccaagccacgacctcccc
cgccggcattccatggaccggcagaactcccaggagaaggcagtgggtgccgcagcctac
ggtgcccgttcccccggtggctccccgggccagtccccacccacgggctactccatcctc
tctcctgcccacttcagcggcccccgctcctccagatacctcggggagttcttaaagaac
gccatccatctggagcctcacaagaaggccatggctgggggccatgtgttcagaaatgcc
cactttgattacagccctgcggggttggcagttcacagggggggacacttcgacaccccc
gtgcagttccttcggcggctggacctctccgaactcctcactcacatccccaggcataag
ctgaacactttccacgtgcgcatggaagacgatgcccaagtgggccagggggaagacttg
cggaagttcattctggccgcgctcagtgccagccacagaaacgtggtaaactgtgccctg
tgccaccgggcgctcccggtgttcgaacagttcccactggtggatggaactttgttccta
agcccgtcgagacatgatgagatcgaatatgatgttccttgtcaccttcaagggagactc
atgcatctgtatgccgtgtgcgtggactgcctggaaggggttcacaagatcatctgcatc
aagtgtaagtcacggtgggatggcagctggcaccagctgggcactatgtacacctacgac
atcctggctgcctctccatgttgtcaggcccgcctgaactgtaagcactgtgggaagccg
gtgatcgacgtgaggatcgggatgcagtacttctccgaatatagcaacgtccagcagtgt
ccacactgtgggaacctggactaccacttcgtgaagccattttcctccttcaaagttctc
gaagcttattga

DBGET integrated database retrieval system