KEGG   Homo sapiens (human): 517Help
Entry
517               CDS       T01001                                 

Gene name
ATP5MC2, ATP5A, ATP5G2
Definition
(RefSeq) ATP synthase membrane subunit c locus 2
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    517 (ATP5MC2)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    517 (ATP5MC2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    517 (ATP5MC2)
   05012 Parkinson's disease
    517 (ATP5MC2)
   05016 Huntington's disease
    517 (ATP5MC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_C Nse5
Motif
Other DBs
NCBI-GeneID: 517
NCBI-ProteinID: NP_001317198
OMIM: 603193
HGNC: 842
Ensembl: ENSG00000135390
Vega: OTTHUMG00000133442
Pharos: Q06055(Tbio)
UniProt: Q06055
Position
12q13.13
AA seq 141 aa AA seqDB search
MFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQ
TSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGF
ALSEAMGLFCLMVAFLILFAM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcctgctccaagtttgtctccactccctccttggtcaagagcacctcacagctg
ctgagccgtccgctatctgcagtggtgctgaaacgaccggagatactgacagatgagagc
ctcagcagcttggcagtctcatgtccccttacctcacttgtctctagccgcagcttccaa
accagcgccatttcaagggacatcgacacagcagccaagttcattggagctggggctgcc
acagttggggtggctggttctggggctgggattggaactgtgtttgggagcctcatcatt
ggttatgccaggaacccttctctgaagcaacagctcttctcctacgccattctgggcttt
gccctctcggaggccatggggctcttttgtctgatggtagcctttctcatcctctttgcc
atgtga

DBGET integrated database retrieval system