KEGG   Homo sapiens (human): 51701Help
Entry
51701             CDS       T01001                                 

Gene name
NLK
Definition
(RefSeq) nemo like kinase
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04068  FoxO signaling pathway
hsa04310  Wnt signaling pathway
hsa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    51701 (NLK)
   04310 Wnt signaling pathway
    51701 (NLK)
   04068 FoxO signaling pathway
    51701 (NLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    51701 (NLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    51701 (NLK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     51701 (NLK)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   51701 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Pkinase_fungal Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 51701
NCBI-ProteinID: NP_057315
OMIM: 609476
HGNC: 29858
Ensembl: ENSG00000087095
Vega: OTTHUMG00000132451
Pharos: Q9UBE8(Tchem)
UniProt: Q9UBE8 A0A024QZ12
Position
17q11.2
AA seq 527 aa AA seqDB search
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcgcaagagccaacgcaaaaatgatggcggcttacaatggcggtaca
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttccacacctccctcct
cctcacctgcaccaccaccaccaccctcaacaccatcttcatccggggtcggctgccgct
gtacaccctgtacagcagcacacctcttcggcagctgcggcagccgcagcagcggctgca
gctgcagccatgttaaaccctgggcaacaacagccatatttcccatcaccggcaccgggg
caggctcctggaccagctgcagcagccccagctcaggtacaggctgccgcagctgctaca
gttaaggcgcaccatcatcagcactcgcatcatccacagcagcagctggatattgagccg
gatagacctattggatatggagcctttggtgttgtctggtcagtaacagatccaagagat
ggaaagagagtagcgctcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agggtcttccgggaattgaagatgttgtgtttttttaagcatgataatgtactctctgcc
cttgacatactccaacctccacacattgactattttgaagaaatatatgttgtcacagaa
ttgatgcagagtgacctacataaaattatcgtctctcctcaaccactcagctcagatcat
gtcaaagtttttctttatcagattttgcgaggtttgaaatatctccattcagctggcatt
ttacatcgagacattaagccagggaatctccttgtgaacagcaactgtgttctaaagatt
tgtgattttggattggccagagtggaagaattagatgaatcccgtcatatgactcaggaa
gttgttactcagtattatcgggctccagaaatcctgatgggcagccgtcattacagcaat
gctattgacatctggtctgtgggatgtatctttgcagaactactaggacgaagaatattg
tttcaggcacagagtcccattcagcagttggatttgatcacggatctgttgggcacacca
tcactggaagcaatgaggacagcttgtgaaggcgctaaggcacatatactcaggggtcct
cataaacagccatctcttcctgtactctataccctgtctagccaggctacacatgaagct
gttcatctcctttgcaggatgttggtctttgatccatccaaaagaatatccgctaaggat
gccttagcccacccctacctagatgaagggcgactacgatatcacacatgtatgtgtaaa
tgttgcttttccacctccactggaagagtttataccagtgactttgagcctgtcaccaat
cccaaatttgatgacactttcgagaagaacctcagttctgtccgacaggttaaagaaatt
attcatcagttcattttggaacagcagaaaggaaacagagtgcctctctgcatcaaccct
cagtctgctgcttttaagagctttattagttccactgttgctcagccatctgagatgccc
ccatctcctctggtgtgggagtga

DBGET integrated database retrieval system