KEGG   Homo sapiens (human): 51702Help
Entry
51702             CDS       T01001                                 

Gene name
PADI3, PAD3, PDI3, UHS1
Definition
(RefSeq) peptidyl arginine deiminase 3
  KO
K01481  protein-arginine deiminase [EC:3.5.3.15]
Organism
hsa  Homo sapiens (human)
Disease
H01796  Uncombable hair syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    51702 (PADI3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     51702 (PADI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAD PAD_M PAD_N
Motif
Other DBs
NCBI-GeneID: 51702
NCBI-ProteinID: NP_057317
OMIM: 606755
HGNC: 18337
Ensembl: ENSG00000142619
Vega: OTTHUMG00000002373
Pharos: Q9ULW8(Tchem)
UniProt: Q9ULW8
Structure
PDB: 

Position
1p36.13
AA seq 664 aa AA seqDB search
MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMFEVYGTPGVDIYISPNMERGR
ERADTRRWRFDATLEIIVVMNSPSNDLNDSHVQISYHSSHEPLPLAYAVLYLTCVDISLD
CDLNCEGRQDRNFVDKRQWVWGPSGYGGILLVNCDRDDPSCDVQDNCDQHVHCLQDLEDM
SVMVLRTQGPAALFDDHKLVLHTSSYDAKRAQVFHICGPEDVCEAYRHVLGQDKVSYEVP
RLHGDEERFFVEGLSFPDAGFTGLISFHVTLLDDSNEDFSASPIFTDTVVFRVAPWIMTP
STLPPLEVYVCRVRNNTCFVDAVAELARKAGCKLTICPQAENRNDRWIQDEMELGYVQAP
HKTLPVVFDSPRNGELQDFPYKRILGPDFGYVTREPRDRSVSGLDSFGNLEVSPPVVANG
KEYPLGRILIGGNLPGSSGRRVTQVVRDFLHAQKVQPPVELFVDWLAVGHVDEFLSFVPA
PDGKGFRMLLASPGACFKLFQEKQKCGHGRALLFQGVVDDEQVKTISINQVLSNKDLINY
NKFVQSCIDWNREVLKRELGLAECDIIDIPQLFKTERKKATAFFPDLVNMLVLGKHLGIP
KPFGPIINGCCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNVCRKPFSFKWW
NMVP
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgcagagaatcgtgcgtgtgtccctggagcatcccaccagcgcggtgtgtgtg
gctggcgtggagaccctcgtggacatttatgggtcagtgcctgagggcacagaaatgttt
gaggtctatgggacgcctggcgtggacatctacatctctcccaacatggagaggggccgg
gagcgtgcagacaccaggcggtggcgctttgacgcgactttggagatcatcgtggtcatg
aactcccccagcaatgacctcaacgacagccatgttcagatttcctaccactccagccat
gagcctctgcccctggcctatgcggtgctctacctcacctgtgttgacatctctctggat
tgcgacctgaactgtgagggaaggcaggacaggaactttgtagacaagcggcagtgggtc
tgggggcccagtgggtatggcggcatcttgctggtgaactgtgaccgtgatgatccgagc
tgtgatgtccaggacaattgtgaccagcacgtgcactgcctgcaagacctggaagacatg
tctgtcatggtcctgcggacgcagggccctgcagccctctttgatgaccacaaacttgtc
ctccatacctccagctatgatgccaaacgggcacaggtcttccacatctgcggtcctgag
gatgtgtgtgaggcctataggcatgtgctgggccaagataaggtgtcctatgaggtaccc
cgcttgcatggggatgaggagcgcttcttcgtggaaggcctgtccttccctgatgccggc
ttcacaggactcatctccttccatgtcactctgctggacgactccaacgaggatttctcg
gcatcccctatcttcactgacactgtggtgttccgagtggcaccctggatcatgacgccc
agcactctgccacccctagaggtgtatgtgtgccgtgtgaggaacaacacgtgttttgtg
gatgcggtggcagagctggccaggaaggccggctgcaagctgaccatctgcccacaggcc
gagaaccgcaacgaccgctggatccaggatgagatggagctgggctacgttcaggcgccg
cacaagaccctcccggtggtctttgactccccaaggaatggggaactgcaggatttccct
tacaaaagaatcctgggtccagattttggttacgtgactcgggaaccacgcgacaggtct
gtgagtggcctggactcctttgggaacctggaggtcagccctccagtggtggccaatggg
aaagagtaccccctggggaggatcctcattgggggcaacctgcctgggtcaagtggccgc
agggtcacccaggtggtgcgggacttcctccatgcccagaaggtgcagccccccgtggag
ctctttgtggactggttggccgtgggccatgtggatgagtttctgagctttgtccctgcc
cccgatgggaagggcttccggatgctcctggccagccctggggcctgcttcaagctcttc
caggaaaagcagaagtgtggccacgggagggccctcctgttccagggggttgttgatgat
gagcaggtcaagaccatctccatcaaccaggtgctctccaataaagacctcatcaactac
aataagtttgtgcagagctgcatcgactggaaccgtgaggtgctgaagcgggagctgggc
ctggcagagtgtgacatcattgacatcccacagctcttcaagaccgagaggaaaaaagca
acggccttcttccctgacttggtgaacatgctggtgctggggaagcacctgggcatcccc
aagccctttgggcccatcatcaatggctgctgctgcctggaggagaaggtgcggtccctg
ctggagccgctgggcctccactgcaccttcattgatgacttcactccataccacatgctg
catggggaggtgcactgtggcaccaatgtgtgcagaaagcccttctctttcaagtggtgg
aacatggtgccctga

DBGET integrated database retrieval system