KEGG   Homo sapiens (human): 51704Help
Entry
51704             CDS       T01001                                 

Gene name
GPRC5B, RAIG-2, RAIG2
Definition
(RefSeq) G protein-coupled receptor class C group 5 member B
  KO
K04619  G protein-coupled receptor family C group 5 member B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    51704 (GPRC5B)
   04030 G protein-coupled receptors [BR:hsa04030]
    51704 (GPRC5B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   51704 (GPRC5B)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Orphan GPRC5
   51704 (GPRC5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_3 RRM_7
Motif
Other DBs
NCBI-GeneID: 51704
NCBI-ProteinID: NP_057319
OMIM: 605948
HGNC: 13308
Ensembl: ENSG00000167191
Vega: OTTHUMG00000131460
Pharos: Q9NZH0(Tbio)
UniProt: Q9NZH0 A0A024QYX2
Position
16p12.3
AA seq 403 aa AA seqDB search
MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVE
AVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDET
ICSVRRFLWGVLFALCFSCLLSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEW
LVLTVLRDTRPACAYEPMDFVMALIYDMVLLVVTLGLALFTLCGKFKRWKLNGAFLLITA
FLSVLIWVAWMTMYLFGNVKLQQGDAWNDPTLAITLAASGWVFVIFHAIPEIHCTLLPAL
QENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPS
GSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtggcatcagagagaaagatgagagctcaccaggtgctcaccttcctcctgctc
ttcgtgatcacctcggtggcctctgaaaacgccagcacatcccgaggctgtgggctggac
ctcctccctcagtacgtgtccctgtgcgacctggacgccatctggggcattgtggtggag
gcggtggccggggcgggcgccctgatcacactgctcctgatgctcatcctcctggtgcgg
ctgcccttcatcaaggagaaggagaagaagagccctgtgggcctccactttctgttcctc
ctggggaccctgggcctctttgggctgacgtttgccttcatcatccaggaggacgagacc
atctgctctgtccgccgcttcctctggggcgtcctctttgcgctctgcttctcctgcctg
ctgagccaggcatggcgcgtgcggaggctggtgcggcatggcacgggccccgcgggctgg
cagctggtgggcctggcgctgtgcctgatgctggtgcaagtcatcatcgctgtggagtgg
ctggtgctcaccgtgctgcgtgacacaaggccagcctgcgcctacgagcccatggacttt
gtgatggccctcatctacgacatggtactgcttgtggtcaccctggggctggccctcttc
actctgtgcggcaagttcaagaggtggaagctgaacggggccttcctcctcatcacagcc
ttcctctctgtgctcatctgggtggcctggatgaccatgtacctcttcggcaatgtcaag
ctgcagcagggggatgcctggaacgaccccaccttggccatcacgctggcggccagcggc
tgggtcttcgtcatcttccacgccatccctgagatccactgcacccttctgccagccctg
caggagaacacgcccaactacttcgacacgtcgcagcccaggatgcgggagacggccttc
gaggaggacgtgcagctgccgcgggcctatatggagaacaaggccttctccatggatgaa
cacaatgcagctctccgaacagcaggatttcccaacggcagcttgggaaaaagacccagt
ggcagcttggggaaaagacccagcgctccgtttagaagcaacgtgtatcagccaactgag
atggccgtcgtgctcaacggtgggaccatcccaactgctccgccaagtcacacaggaaga
cacctttggtga

DBGET integrated database retrieval system