KEGG   Homo sapiens (human): 51706Help
Entry
51706             CDS       T01001                                 

Gene name
CYB5R1, B5R.1, B5R1, B5R2, NQO3A2, humb5R2
Definition
(RefSeq) cytochrome b5 reductase 1
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    51706 (CYB5R1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     51706 (CYB5R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 51706
NCBI-ProteinID: NP_057327
OMIM: 608341
HGNC: 13397
Ensembl: ENSG00000159348
Vega: OTTHUMG00000041387
Pharos: Q9UHQ9(Tbio)
UniProt: Q9UHQ9
Position
1q32.1
AA seq 305 aa AA seqDB search
MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHN
TKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKG
VHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLG
MIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLW
FTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQK
MRFTY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggggatccagacgagccccgtcctgctggcctccctgggggtggggctggtcactctg
ctcggcctggctgtgggctcctacttggttcggaggtcccgccggcctcaggtcactctc
ctggaccccaatgaaaagtacctgctacgactgctagacaagacgactgtgagccacaac
accaagaggttccgctttgccctgcccaccgcccaccacactctggggctgcctgtgggc
aaacatatctacctctccacccgaattgatggcagcctggtcatcaggccatacactcct
gtcaccagtgatgaggatcaaggctatgtggatcttgtcatcaaggtctacctgaagggt
gtgcaccccaaatttcctgagggagggaagatgtctcagtacctggatagcctgaaggtt
ggggatgtggtggagtttcgggggccaagcgggttgctcacttacactggaaaagggcat
tttaacattcagcccaacaagaaatctccaccagaaccccgagtggcgaagaaactggga
atgattgccggcgggacaggaatcaccccaatgctacagctgatccgggccatcctgaaa
gtccctgaagatccaacccagtgctttctgctttttgccaaccagacagaaaaggatatc
atcttgcgggaggacttagaggaactgcaggcccgctatcccaatcgctttaagctctgg
ttcactctggatcatcccccaaaagattgggcctacagcaagggctttgtgactgccgac
atgatccgggaacacctgcccgctccaggggatgatgtgctggtactgctttgtgggcca
cccccaatggtgcagctggcctgccatcccaacttggacaaactgggctactcacaaaag
atgcgattcacctactga

DBGET integrated database retrieval system