KEGG   Homo sapiens (human): 51719Help
Entry
51719             CDS       T01001                                 

Gene name
CAB39, CGI-66, MO25
Definition
(RefSeq) calcium binding protein 39
  KO
K08272  calcium binding protein 39
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    51719 (CAB39)
   04150 mTOR signaling pathway
    51719 (CAB39)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mo25
Motif
Other DBs
NCBI-GeneID: 51719
NCBI-ProteinID: NP_001124321
OMIM: 612174
HGNC: 20292
Ensembl: ENSG00000135932
Vega: OTTHUMG00000133220
Pharos: Q9Y376(Tbio)
UniProt: Q9Y376 A0A024R496
Structure
PDB: 

Position
2q37.1
AA seq 341 aa AA seqDB search
MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEK
EPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYI
CTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDI
ASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDR
HNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQA
KLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcccgtttgggaagtctcacaaatctccagcagacattgtgaagaatctgaag
gagagcatggctgttctggaaaagcaagacatttctgataaaaaagcagaaaaggctaca
gaagaagtttccaaaaatctggttgccatgaaagaaattctgtatggcacaaatgaaaaa
gagcctcagacagaagcagtagctcaacttgctcaagaactctataatagtgggctcctt
agcaccctggtagctgatttacagctcattgactttgagggcaaaaaagacgtggctcaa
attttcaacaatattctcagaagacaaattggtacgagaactcctactgttgaatacatc
tgcacccaacagaatattttgttcatgttattgaaagggtatgaatctccagaaatagct
ctaaattgtggaataatgttaagagaatgcatcagacatgaaccacttgcaaaaatcatt
ttgtggtcggaacagttttatgatttcttcagatatgtcgaaatgtcaacatttgacata
gcttcagatgcatttgccacattcaaggatttacttacaagacataaattgctcagtgca
gaatttttggaacagcattatgatagatttttcagtgaatatgagaagttacttcattca
gaaaattatgtgacaaaaagacagtcactgaagcttctcggtgaactactactagataga
cacaacttcacaattatgacaaaatacatcagtaaacctgagaacctcaaattaatgatg
aacctgctgcgagacaaaagtcgcaacatccagtttgaggcctttcacgtttttaaggtg
tttgtagccaatcctaacaagacgcagcccatcctagacatcctcctcaagaaccaggcc
aaactcatagagttcctcagcaagtttcagaacgacaggacggaggatgagcagtttaac
gacgagaagacctatttagttaaacagatcagggatttgaagagaccagctcagcaagaa
gcttaa

DBGET integrated database retrieval system