KEGG   Homo sapiens (human): 51726
Entry
51726             CDS       T01001                                 

Symbol
DNAJB11, ABBP-2, ABBP2, DJ9, Dj-9, EDJ, ERdj3, ERj3, ERj3p, PKD6, PRO1080, UNQ537
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member B11
  KO
K09517  DnaJ homolog subfamily B member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H00542  Polycystic kidney disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    51726 (DNAJB11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    51726 (DNAJB11)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   51726 (DNAJB11)
SSDB
Motif
Pfam: DnaJ_C DnaJ
Other DBs
NCBI-GeneID: 51726
NCBI-ProteinID: NP_057390
OMIM: 611341
HGNC: 14889
Ensembl: ENSG00000090520
Vega: OTTHUMG00000156614
Pharos: Q9UBS4(Tbio)
UniProt: Q9UBS4
Position
3q27.3
AA seq 358 aa
MAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDD
PQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGT
PRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQL
GPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLR
FRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLW
KKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggctccgcagaacctgagcaccttttgcctgttgctgctatacctcatcggggcggtg
attgccggacgagatttctataagatcttgggggtgcctcgaagtgcctctataaaggat
attaaaaaggcctataggaaactagccctgcagcttcatcccgaccggaaccctgatgat
ccacaagcccaggagaaattccaggatctgggtgctgcttatgaggttctgtcagatagt
gagaaacggaaacagtacgatacttatggtgaagaaggattaaaagatggtcatcagagc
tcccatggagacattttttcacacttctttggggattttggtttcatgtttggaggaacc
cctcgtcagcaagacagaaatattccaagaggaagtgatattattgtagatctagaagtc
actttggaagaagtatatgcaggaaattttgtggaagtagttagaaacaaacctgtggca
aggcaggctcctggcaaacggaagtgcaattgtcggcaagagatgcggaccacccagctg
ggccctgggcgcttccaaatgacccaggaggtggtctgcgacgaatgccctaatgtcaaa
ctagtgaatgaagaacgaacgctggaagtagaaatagagcctggggtgagagacggcatg
gagtacccctttattggagaaggtgagcctcacgtggatggggagcctggagatttacgg
ttccgaatcaaagttgtcaagcacccaatatttgaaaggagaggagatgatttgtacaca
aatgtgacaatctcattagttgagtcactggttggctttgagatggatattactcacttg
gatggtcacaaggtacatatttcccgggataagatcaccaggccaggagcgaagctatgg
aagaaaggggaagggctccccaactttgacaacaacaatatcaagggctctttgataatc
acttttgatgtggattttccaaaagaacagttaacagaggaagcgagagaaggtatcaaa
cagctactgaaacaagggtcagtgcagaaggtatacaatggactgcaaggatattga

KEGG   Homo sapiens (human): 54431
Entry
54431             CDS       T01001                                 

Symbol
DNAJC10, ERdj5, JPDI, MTHr, PDIA19
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member C10
  KO
K09530  DnaJ homolog subfamily C member 10 [EC:1.8.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    54431 (DNAJC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    54431 (DNAJC10)
   04131 Membrane trafficking [BR:hsa04131]
    54431 (DNAJC10)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     54431 (DNAJC10)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   54431 (DNAJC10)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    54431 (DNAJC10)
SSDB
Motif
Pfam: Thioredoxin DnaJ Thioredoxin_2 OST3_OST6 Thioredoxin_8 Thioredoxin_6 Thioredoxin_7 Redoxin AhpC-TSA TraF
Other DBs
NCBI-GeneID: 54431
NCBI-ProteinID: NP_061854
OMIM: 607987
HGNC: 24637
Ensembl: ENSG00000077232
Vega: OTTHUMG00000154209
Pharos: Q8IXB1(Tbio)
UniProt: Q8IXB1
Position
2q32.1
AA seq 793 aa
MGVWLNKDDYIRDLKRIILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLAL
KLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWNYYRY
DFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEVDGLLR
IGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSFAMQHVRSTVTEL
WTGNFVNSIQTAFAAGIGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCATQDNL
CKSLDITTSTTAYFPPGATLNNKEKNSILFLNSLDAKEIYLEVIHNLPDFELLSANTLED
RLAHHRWLLFFHFGKNENSNDPELKKLKTLLKNDHIQVGRFDCSSAPDICSNLYVFQPSL
AVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDFFAPWC
PPCRALLPELRRASNLLYGQLKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGH
HSAEQILEFIEDLMNPSVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKR
MARTLTGLINVGSIDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYHYHSYNGWNRDAYSL
RIWGLGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLARMIKGK
VKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLE
TLRNQGKRNKDEL
NT seq 2382 nt   +upstreamnt  +downstreamnt
atgggagtctggttaaataaagatgactatatcagagacttgaaaaggatcattctctgt
tttctgatagtgtatatggccattttagtgggcacagatcaggatttttacagtttactt
ggagtgtccaaaactgcaagcagtagagaaataagacaagctttcaagaaattggcattg
aagttacatcctgataaaaacccgaataacccaaatgcacatggcgattttttaaaaata
aatagagcatatgaagtactcaaagatgaagatctacggaaaaagtatgacaaatatgga
gaaaagggacttgaggataatcaaggtggccagtatgaaagctggaactattatcgttat
gattttggtatttatgatgatgatcctgaaatcataacattggaaagaagagaatttgat
gctgctgttaattctggagaactgtggtttgtaaatttttactccccaggctgttcacac
tgccatgatttagctcccacatggagagactttgctaaagaagtggatgggttacttcga
attggagctgttaactgtggtgatgatagaatgctttgccgaatgaaaggagtcaacagc
tatcccagcctcttcatttttcggtctggaatggccccagtgaaatatcatggagacaga
tcaaaggagagtttagtgagttttgcaatgcagcatgttagaagtacagtgacagaactt
tggacaggaaattttgtcaactccatacaaactgcttttgctgctggtattggctggctg
atcactttttgttcaaaaggaggagattgtttgacttcacagacacgactcaggcttagt
ggcatgttggatggtcttgttaatgtaggatggatggactgtgccacccaggataacctt
tgtaaaagcttagatattacaacaagtactactgcttattttcctcctggagccacttta
aataacaaagagaaaaacagtattttgtttctcaactcattggatgctaaagaaatatat
ttggaagtaatacataatcttccagattttgaactactttcggcaaacacactagaggat
cgtttggctcatcatcggtggctgttattttttcattttggaaaaaatgaaaattcaaat
gatcctgagctgaaaaaactaaaaactctacttaaaaatgatcatattcaagttggcagg
tttgactgttcctctgcaccagacatctgtagtaatctgtatgtttttcagccgtctcta
gcagtatttaaaggacaaggaaccaaagaatatgaaattcatcatggaaagaagattcta
tatgatatacttgcctttgccaaagaaagtgtgaattctcatgttaccacgcttggacct
caaaattttcctgccaatgacaaagaaccatggcttgttgatttctttgccccctggtgt
ccaccatgtcgagctttactaccagagttacgaagagcatcaaatcttctttatggtcag
cttaagtttggtacactagattgtacagttcatgagggactctgtaacatgtataacatt
caggcttatccaacaacagtggtattcaaccagtccaacattcatgagtatgaaggacat
cactctgctgaacaaatcttggagttcatagaggatcttatgaatccttcagtggtctcc
cttacacccaccaccttcaacgaactagttacacaaagaaaacacaacgaagtctggatg
gttgatttctattctccgtggtgtcatccttgccaagtcttaatgccagaatggaaaaga
atggcccggacattaactggactgatcaacgtgggcagtatagattgccaacagtatcat
tctttttgtgcccaggaaaacgttcaaagataccctgagataagattttttcccccaaaa
tcaaataaagcttatcattatcacagttacaatggttggaatagggatgcttattccctg
agaatctggggtctaggatttttacctcaagtatccacagatctaacacctcagactttc
agtgaaaaagttctacaagggaaaaatcattgggtgattgatttctatgctccttggtgt
ggaccttgccagaattttgctccagaatttgagctcttggctaggatgattaaaggaaaa
gtgaaagctggaaaagtagactgtcaggcttatgctcagacatgccagaaagctgggatc
agggcctatccaactgttaaattttatttctacgaaagagcaaagagaaattttcaagaa
gagcagataaataccagagatgcaaaagcaatcgctgccttaataagtgaaaaattggaa
actctccgaaatcaaggcaagaggaataaggatgaactttga

KEGG   Homo sapiens (human): 5611
Entry
5611              CDS       T01001                                 

Symbol
DNAJC3, ACPHD, ERdj6, HP58, P58, P58IPK, PRKRI, p58(IPK)
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member C3
  KO
K09523  DnaJ homolog subfamily C member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05164  Influenza A
Network
nt06138  PKR-eIF2alpha signaling (viruses)
nt06170  Influenza A virus (IAV)
  Element
N00726  IAV NP to PKR-eIF2alpha signaling pathway
Disease
H02430  Ataxia, combined cerebellar and peripheral, with hearing loss and diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5611 (DNAJC3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    5611 (DNAJC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    5611 (DNAJC3)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   5611 (DNAJC3)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_19 DnaJ TPR_16 TPR_8 TPR_14 TPR_11 TPR_9 TPR_12 TPR_17 TPR_20 ANAPC3 TPR_21 TPR_6 PRAI TPR_10 Ndufs5
Other DBs
NCBI-GeneID: 5611
NCBI-ProteinID: NP_006251
OMIM: 601184
HGNC: 9439
Ensembl: ENSG00000102580
Vega: OTTHUMG00000017227
Pharos: Q13217(Tbio)
UniProt: Q13217 A8KA82
Structure
PDB: 
2Y4T 2Y4U

Position
13q32.1
AA seq 504 aa
MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQF
HAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK
LDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQRLRSQALNAFGSGDYTAAIAFLDKI
LEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISTLYYQLGDHEL
SLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPS
IAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAYLIEEMYDEAI
QDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ
WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHR
SWNSWQGFNPFSSGGPFRFKFHFN
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggtggcccccggctccgtgaccagccggctgggctcggtattccccttcctgctagtc
ctggtggatctgcagtacgaaggtgctgaatgtggagtaaatgcagatgttgagaaacat
cttgaattgggcaagaaattacttgcagctggacagctagctgatgctttatctcagttt
catgctgccgtagatggtgaccctgataactatattgcttattatcggagggctactgtc
tttttagctatgggcaaatcaaaagctgcacttcctgatttaactaaagtgattcaattg
aagatggacttcactgcagcaagattacagagaggtcacttattactcaaacaaggaaaa
cttgatgaagcagaagatgattttaaaaaagtgctcaaatctaatccaagtgaaaatgaa
gaaaaggaagcacagtctcaacttataaaatctgatgaaatgcagcgtttgcgttcacaa
gcacttaacgcttttggaagtggagattatactgctgctatagccttccttgataagatt
ttagaggtttgtgtttgggatgcagaactacgggaacttcgagctgaatgttttataaaa
gaaggagaacctaggaaagctataagtgacttaaaagctgcgtcaaagttgaagaatgat
aatactgaagcgttttataaaataagcacactgtactaccaactaggagaccacgaactg
tccctcagtgaagttcgggaatgtcttaaacttgaccaggatcataaaaggtgttttgca
cactataaacaagtaaagaaacttaataagctgattgagtcagctgaagagctcatcaga
gatggcagatacacagatgctaccagcaaatatgaatctgtcatgaaaacagagccaagc
attgctgaatatacagttcgttcaaaggagaggatttgccactgcttttctaaggacgag
aagcctgttgaagctattagggtttgttctgaagttttacagatggaacctgacaatgtg
aatgccctgaaagatcgagcagaggcctatttgatagaggaaatgtatgatgaagctatt
caggattatgaaactgctcaggaacacaatgaaaatgatcagcagattcgagaaggtcta
gagaaagcacaaagattattgaaacagtcgcagaaacgagattattataaaatcttggga
gtaaaaagaaatgccaaaaagcaagaaattattaaagcataccgaaaattagcactgcag
tggcacccagataacttccagaatgaagaagaaaagaaaaaagctgagaaaaagttcatt
gatatagcagctgctaaagaagtcctctctgatccagaaatgagaaagaagtttgacgac
ggagaagatcctttggatgcagagagccagcaaggaggcggcggcaaccctttccacaga
agctggaactcatggcaagggttcaatcccttcagctcaggcggaccatttagatttaaa
ttccacttcaattaa

KEGG   Homo sapiens (human): 64215
Entry
64215             CDS       T01001                                 

Symbol
DNAJC1, DNAJL1, ERdj1, HTJ1, MTJ1
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member C1
  KO
K09521  DnaJ homolog subfamily C member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    64215 (DNAJC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    64215 (DNAJC1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   64215 (DNAJC1)
SSDB
Motif
Pfam: DnaJ Myb_DNA-binding Myb_DNA-bind_6 DUF4234
Other DBs
NCBI-GeneID: 64215
NCBI-ProteinID: NP_071760
OMIM: 611207
HGNC: 20090
Ensembl: ENSG00000136770
Vega: OTTHUMG00000017800
Pharos: Q96KC8(Tdark)
UniProt: Q96KC8
Structure
PDB: 
2CQQ 2CQR

Position
10p12.31
AA seq 554 aa
MTAPCSQPAQLPGRRQLGLVPFPPPPPRTPLLWLLLLLLAAVAPARGWESGDLELFDLVE
EVQLNFYQFLGVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDE
RRQRYDDILINGLPDWRQPVFYYRRVRKMSNAELALLLFIILTVGHYAVVWSIYLEKQLD
ELLSRKKREKKKKTGSKSVDVSKLGASEKNERLLMKPQWHDLLPCKLGIWFCLTLKALPH
LIQDAGQFYAKYKETRLKEKEDALTRTELETLQKQKKVKKPKPEFPVYTPLETTYIQSYD
HGTSIEEIEEQMDDWLENRNRTQKKQAPEWTEEDLSQLTRSMVKFPGGTPGRWEKIAHEL
GRSVTDVTTKAKQLKDSVTCSPGMVRLSELKSTVQNSRPIKTATTLPDDMITQREDAEGV
AAEEEQEGDSGEQETGATDARPRRRKPARLLEATAKPEPEEKSRAKRQKDFDIAEQNESS
DEESLRKERARSAEEPWTQNQQKLLELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYK
LLVELVQKKKQAKS
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgacggctccttgctcccagccggcgcagcttcctggacgccgccagctcgggctggtg
ccgttcccgccgccgccgccgcggacgccgctgctgtggctgctgctgctgctgctggcc
gccgtggcgccggcgcgcggctgggagagcggagacctggagttgtttgacttagtggag
gaggtgcagctcaacttctaccagttcctcggggtgcagcaggatgcatcatctgcagac
atcagaaaagcatatcgtaagctttcactaactttacatccagacaagaataaagatgaa
aatgcagaaactcagtttagacaattggtggccatttatgaagttttaaaggatgatgaa
cgaaggcagaggtatgatgatattctgatcaatggacttccagattggcgacagcctgta
ttctactacaggcgggtgagaaaaatgagcaatgctgagctggcattactcttgttcatt
attctcacagtgggtcattatgctgtggtttggtcaatctacctggaaaaacaactggat
gaactactaagtagaaaaaagagagaaaagaaaaaaaagactggcagcaagagtgtggat
gtatcaaaactcggtgcttcagaaaaaaatgaaagattgctgatgaaaccacagtggcat
gatttgcttccatgcaaactggggatttggttttgccttacactaaaagcattacctcac
ctcatccaggatgctgggcagttttatgctaaatataaagaaacaagattgaaggaaaag
gaagatgcactgactagaactgaacttgaaacacttcaaaaacagaagaaagttaaaaaa
ccaaaacctgaatttcctgtatacacacctttagaaactacatatattcagtcttatgat
catggaacttccatagaagaaattgaggaacaaatggatgattggttggaaaacaggaac
cgaacacagaaaaaacaggcacctgaatggacagaagaggacctcagccaactgacaaga
agtatggttaagttcccaggagggactccaggtcgatgggaaaagattgcccacgaattg
ggtcgatctgtgacagatgtgacaaccaaagccaagcaactgaaggattcagtgacctgc
tccccaggaatggttagactctccgaactcaaatcgacagttcagaattccaggcccatc
aaaacggccaccaccttgcccgatgacatgatcacccagcgagaggacgcagagggggtg
gcagcggaggaggagcaggagggagactccggtgagcaggagaccggggccactgatgcc
cggcctcggaggcggaagccagccaggctgctggaggctacagcgaagccggagccagag
gagaagtccagagccaagcggcagaaggactttgacatagcagaacaaaacgagtccagc
gacgaggagagcctgagaaaagagagagctcggtctgcagaggagccgtggactcaaaat
caacagaaacttctggaactggcgttgcagcagtacccaaggggatcctctgaccgctgg
gacaaaatagccagatgtgtcccgtccaagagcaaggaagactgtatcgctaggtacaag
ttgctggttgaactggtccaaaagaaaaaacaagctaaaagctga

DBGET integrated database retrieval system