KEGG   Homo sapiens (human): 51727Help
Entry
51727             CDS       T01001                                 

Gene name
CMPK1, CK, CMK, CMPK, UMK, UMP-CMPK, UMPK
Definition
(RefSeq) cytidine/uridine monophosphate kinase 1
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Module
hsa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    51727 (CMPK1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    51727 (CMPK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     51727 (CMPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK AAA_17 Thymidylate_kin AAA_18 Zeta_toxin AAA AAA_19 Ploopntkinase3
Motif
Other DBs
NCBI-GeneID: 51727
NCBI-ProteinID: NP_001129612
OMIM: 191710
HGNC: 18170
Ensembl: ENSG00000162368
Vega: OTTHUMG00000007849
Pharos: P30085(Tbio)
UniProt: P30085
Structure
PDB: 

Position
1p33
AA seq 179 aa AA seqDB search
MLSRCRSGLLHVLGLSFLLQTRRPILLCSPRLMKPLVVFVLGGPGAGKGTQCARIVEEMD
QTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKS
SGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKEG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgctgagccgctgccgcagcgggctgctccacgtcctgggccttagcttcctgctgcag
acccgccggccgattctcctctgctctccacgtctcatgaagccgctggtcgtgttcgtc
ctcggcggccccggcgccggcaaggggacccagtgcgcccgcatcgtcgaggaaatggat
cagacaatggctgccaatgctcagaagaataaattcttgattgatgggtttccaagaaat
caagacaaccttcaaggatggaacaagaccatggatgggaaggcagatgtatctttcgtt
ctcttttttgactgtaataatgagatttgtattgaacgatgtcttgagaggggaaagagt
agtggtaggagtgatgacaacagagagagcttggaaaagagaattcagacctaccttcag
tcaacaaagccaattattgacttatatgaagaaatggggaaagtcaagaaaatagatgct
tctaaatctgttgatgaagtttttgatgaagttgtgcagatttttgacaaggaaggctaa

DBGET integrated database retrieval system