KEGG   Homo sapiens (human): 51741Help
Entry
51741             CDS       T01001                                 

Gene name
WWOX, D16S432E, EIEE28, FOR, FRA16D, HHCMA56, PRO0128, SCAR12, SDR41C1, WOX1
Definition
(RefSeq) WW domain containing oxidoreductase
  KO
K19329  WW domain-containing oxidoreductase
Organism
hsa  Homo sapiens (human)
Disease
H00606  Early infantile epileptic encephalopathy
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    51741 (WWOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short WW adh_short_C2 KR
Motif
Other DBs
NCBI-GeneID: 51741
NCBI-ProteinID: NP_057457
OMIM: 605131
HGNC: 12799
Ensembl: ENSG00000186153
Vega: OTTHUMG00000176851
Pharos: Q9NZC7(Tbio)
UniProt: Q9NZC7 A0A411HBC7
Structure
PDB: 

Position
16q23.1-q23.2
AA seq 414 aa AA seqDB search
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLP
YGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGR
DFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAM
TLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLV
QLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCN
ILFSNELHRRLSPRGVTSNAVHPGNMMYSNIHRSWWVYTLLFTLARPFTKSMQQGAATTV
YCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgctgcgctacgcggggctggacgacacggacagtgaggacgagctgcctccg
ggctgggaggagagaaccaccaaggacggctgggtttactacgccaatcacaccgaggag
aagactcagtgggaacatccaaaaactggaaaaagaaaacgagtggcaggagatttgcca
tacggatgggaacaagaaactgatgagaacggacaagtgttttttgttgaccatataaat
aaaagaaccacctacttggacccaagactggcgtttactgtggatgataatccgaccaag
ccaaccacccggcaaagatacgacggcagcaccactgccatggaaattctccagggccgg
gatttcactggcaaagtggttgtggtcactggagctaattcaggaatagggttcgaaacc
gccaagtcttttgccctccatggtgcacatgtgatcttggcctgcaggaacatggcaagg
gcgagtgaagcagtgtcacgcattttagaagaatggcataaagccaaggtagaagcaatg
accctggacctcgctctgctccgtagcgtgcagcattttgctgaagcattcaaggccaag
aatgtgcctcttcatgtgcttgtgtgcaacgcagcaacttttgctctaccctggagtctc
accaaagatggcctggagaccacctttcaagtgaatcatctggggcacttctaccttgtc
cagctcctccaggatgttttgtgccgctcagctcctgcccgtgtcattgtggtctcctca
gagtcccatcgatttacagatattaacgactccttgggaaaactggacttcagtcgcctc
tctccaacaaaaaacgactattgggcgatgctggcttataacaggtccaagctctgcaac
atcctcttctccaacgagctgcaccgtcgcctctccccacgcggggtcacgtcgaacgca
gtgcatcctggaaatatgatgtactccaacattcatcgcagctggtgggtgtacacactg
ctgtttaccttggcgaggcctttcaccaagtccatgcaacagggagctgccaccaccgtg
tactgtgctgctgtcccagaactggagggtctgggagggatgtacttcaacaactgctgc
cgctgcatgccctcaccagaagctcagagcgaagagacggcccggaccctgtgggcgctc
agcgagaggctgatccaagaacggcttggcagccagtccggctaa

DBGET integrated database retrieval system