KEGG   Homo sapiens (human): 5175Help
Entry
5175              CDS       T01001                                 

Gene name
PECAM1, CD31, CD31/EndoCAM, GPIIA', PECA1, PECAM-1, endoCAM
Definition
(RefSeq) platelet and endothelial cell adhesion molecule 1
  KO
K06471  platelet/endothelial cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04670  Leukocyte transendothelial migration
hsa05144  Malaria
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5175 (PECAM1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    5175 (PECAM1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5175 (PECAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    5175 (PECAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    5175 (PECAM1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5175 (PECAM1)
   04091 Lectins [BR:hsa04091]
    5175 (PECAM1)
CD molecules [BR:hsa04090]
 Proteins
  5175 (PECAM1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Adhesion molecules of cell surface
   5175 (PECAM1)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  5175 (PECAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig Ig_C17orf99 I-set Izumo-Ig V-set Ig_6 MAP17 C2-set
Motif
Other DBs
NCBI-GeneID: 5175
NCBI-ProteinID: NP_000433
OMIM: 173445
HGNC: 8823
Ensembl: ENSG00000261371
Vega: OTTHUMG00000175829
Pharos: P16284(Tdark)
UniProt: P16284
Structure
PDB: 

Position
17q23.3
AA seq 738 aa AA seqDB search
MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFAD
VSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTT
AEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKRE
KNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHI
SPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNRHGNKAVYSVMAMVEHSG
NYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIPGAPPANFTIQ
KEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE
VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADN
CHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREK
EGKPFYQMTSNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWK
KGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEAN
SHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAV
PDAVESRYSRTEGSLDGT
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgaggtgggcccaaggggccacgatgtggcttggagtcctgctgacccttctg
ctctgttcaagccttgagggtcaagaaaactctttcacaatcaacagtgttgacatgaag
agcctgccggactggacggtgcaaaatgggaagaacctgaccctgcagtgcttcgcggat
gtcagcaccacctctcacgtcaagcctcagcaccagatgctgttctataaggatgacgtg
ctgttttacaacatctcctccatgaagagcacagagagttattttattcctgaagtccgg
atctatgactcagggacatataaatgtactgtgattgtgaacaacaaagagaaaaccact
gcagagtaccaggtgttggtggaaggagtgcccagtcccagggtgacactggacaagaaa
gaggccatccaaggtgggatcgtgagggtcaactgttctgtcccagaggaaaaggcccca
atacacttcacaattgaaaaacttgaactaaatgaaaaaatggtcaagctgaaaagagag
aagaattctcgagaccagaattttgtgatactggaattccccgttgaggaacaggaccgc
gttttatccttccgatgtcaagctaggatcatttctgggatccatatgcagacctcagaa
tctaccaagagtgaactggtcaccgtgacggaatccttctctacacccaagttccacatc
agccccaccggaatgatcatggaaggagctcagctccacattaagtgcaccattcaagtg
actcacctggcccaggagtttccagaaatcataattcagaaggacaaggcgattgtggcc
cacaacagacatggcaacaaggctgtgtactcagtcatggccatggtggagcacagtggc
aactacacgtgcaaagtggagtccagccgcatatccaaggtcagcagcatcgtggtcaac
ataacagaactattttccaagcccgaactggaatcttccttcacacatctggaccaaggt
gaaagactgaacctgtcctgctccatcccaggagcacctccagccaacttcaccatccag
aaggaagatacgattgtgtcacagactcaagatttcaccaagatagcctcaaagtcggac
agtgggacgtatatctgcactgcaggtattgacaaagtggtcaagaaaagcaacacagtc
cagatagtcgtatgtgaaatgctctcccagcccaggatttcttatgatgcccagtttgag
gtcataaaaggacagaccatcgaagtccgttgcgaatcgatcagtggaactttgcctatt
tcttaccaacttttaaaaacaagtaaagttttggagaatagtaccaagaactcaaatgat
cctgcggtattcaaagacaaccccactgaagacgtcgaataccagtgtgttgcagataat
tgccattcccatgccaaaatgttaagtgaggttctgagggtgaaggtgatagccccggtg
gatgaggtccagatttctatcctgtcaagtaaggtggtggagtctggagaggacattgtg
ctgcaatgtgctgtgaatgaaggatctggtcccatcacctataagttttacagagaaaaa
gagggcaaacccttctatcaaatgacctcaaatgccacccaggcattttggaccaagcag
aaggctagcaaggaacaggagggagagtattactgcacagccttcaacagagccaaccac
gcctccagtgtccccagaagcaaaatactgacagtcagagtcattcttgccccatggaag
aaaggacttattgcagtggttatcatcggagtgatcattgctctcttgatcattgcggcc
aaatgttattttctgaggaaagccaaggccaagcagatgccagtggaaatgtccaggcca
gcagtaccacttctgaactccaacaacgagaaaatgtcagatcccaatatggaagctaac
agtcattacggtcacaatgacgatgtcagaaaccatgcaatgaaaccaataaatgataat
aaagagcctctgaactcagacgtgcagtacacggaagttcaagtgtcctcagctgagtct
cacaaagatctaggaaagaaggacacagagacagtgtacagtgaagtccggaaagctgtc
cctgatgccgtggaaagcagatactctagaacggaaggctcccttgatggaacttag

DBGET integrated database retrieval system